KEGG   Helicobacter pylori SJM180: HPSJM_06405Help
Entry
HPSJM_06405       CDS       T01323                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hpm  Helicobacter pylori SJM180
Pathway
hpm00260  Glycine, serine and threonine metabolism
hpm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpm01100  Metabolic pathways
hpm01110  Biosynthesis of secondary metabolites
hpm01130  Biosynthesis of antibiotics
hpm01230  Biosynthesis of amino acids
Module
hpm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPSJM_06405 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPSJM_06405 (trpA)
Enzymes [BR:hpm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPSJM_06405 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: ADO02845
UniProt: E1Q137
Position
complement(1297101..1297889)
Genome map
AA seq 262 aa AA seqDB search
MRYQNMFETLKKHEKMAFIPFVTLGDPNYEWSFEIIKTLIDSGVSALELGFAFSDPVADG
VTIQASHLRALKHASMAKNFQLLKKIRGYNHDIPIGLLAYANLIFSYGVDGFYAQAKECG
IDSVLIADMPLIEKELVIKSAQKHQIKQIFIASPNASSKDLEQVATHSQGYIYTLARSGV
TGASHTLENDASAIIKTLKTFSPTPALLGFGISQKEHITNAKGMGADGVICGSALVKIIE
ENLNNEDAMLEKIKGFIGGMIF
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaggtatcaaaacatgtttgaaaccttaaaaaaacacgaaaaaatggcgtttatcccg
tttgtaaccttgggcgatcctaattatgaatggagttttgaaatcattaaaaccttaatt
gatagcggggtgagtgctttggaattgggctttgctttctcagatcctgtagcggatggc
gttaccatacaagcgagccatttaagggcgttaaaacacgctagcatggctaaaaatttc
cagcttttaaaaaagattagaggctacaaccatgatattcccatagggcttttagcgtat
gcgaatttaattttttcttatggcgttgatggcttttacgctcaagctaaagaatgcggt
atagatagcgttttaatagcggacatgcccctaatagaaaaagaattagtcatcaaatcc
gctcaaaaacaccaaatcaagcaaatctttatcgccagccccaatgcgagcagtaaagat
ttagaacaagtcgctacgcattcgcaaggctatatctacactttagccaggagtggggtt
acaggggcgagccatactttagaaaatgacgcgagcgctattattaaaaccttaaaaacc
tttagccctacccccgcattactaggctttggcatttctcaaaaagaacacatcacaaac
gctaaaggcatgggcgctgatggcgtgatttgcggatcagcgttagtcaaaatcatagaa
gaaaatttaaacaatgaagacgccatgctagaaaaaattaaagggtttataggaggaatg
attttttaa

DBGET integrated database retrieval system