KEGG   Helicobacter pylori India7: HPIN_03195Help
Entry
HPIN_03195        CDS       T01918                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hpn  Helicobacter pylori India7
Pathway
hpn00071  Fatty acid degradation
hpn00072  Synthesis and degradation of ketone bodies
hpn00280  Valine, leucine and isoleucine degradation
hpn00310  Lysine degradation
hpn00362  Benzoate degradation
hpn00380  Tryptophan metabolism
hpn00620  Pyruvate metabolism
hpn00630  Glyoxylate and dicarboxylate metabolism
hpn00640  Propanoate metabolism
hpn00650  Butanoate metabolism
hpn00900  Terpenoid backbone biosynthesis
hpn01100  Metabolic pathways
hpn01110  Biosynthesis of secondary metabolites
hpn01120  Microbial metabolism in diverse environments
hpn01130  Biosynthesis of antibiotics
hpn01200  Carbon metabolism
hpn01212  Fatty acid metabolism
hpn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hpn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPIN_03195
   00630 Glyoxylate and dicarboxylate metabolism
    HPIN_03195
   00640 Propanoate metabolism
    HPIN_03195
   00650 Butanoate metabolism
    HPIN_03195
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HPIN_03195
   00072 Synthesis and degradation of ketone bodies
    HPIN_03195
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HPIN_03195
   00310 Lysine degradation
    HPIN_03195
   00380 Tryptophan metabolism
    HPIN_03195
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPIN_03195
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HPIN_03195
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HPIN_03195
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpn04147]
    HPIN_03195
Enzymes [BR:hpn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HPIN_03195
Exosome [BR:hpn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPIN_03195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ADU79875
UniProt: E8QFW3
Position
complement(629705..630880)
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAVGSFLGSLKSVGAREMGVCVLKDALNASGLEPSDVDSVILGNVLGAG
LGQNIARQIQLDAGIPNDKNAFSVNMVCGSSMKAIQLAHDAIMLGRDEVVVCGGVENMSK
APYLSFDMRDGKRMGNANMIDSMVHDGLWDAFNDYHMGITADNVAQAYHISREEQDNFAL
QSQLKARAAINAKKFQEEITPIEIANKKGVVVFKEDEYPRDTTLESLAKLKPAFKKDGSV
TAGNSSGINDGASIIILCSAKKVQTLGLKAMATIKGFGLGGCSPDIMGICPSIAIKNNLK
NVKMNLNDINLFELNEAFAAQSIAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSGHGVGCASLCVGGGQGLSVVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtggtagcggcaaaacgaagcgcggttgggagttttttaggctct
ctaaagagcgtgggcgctagagaaatgggtgtttgcgtgcttaaagatgctttgaatgcg
agcggtcttgagcctagcgatgtggattctgtcattttaggcaatgttttaggcgctggt
ttgggtcaaaatatcgccaggcagatccaactagacgctggcatccctaatgacaaaaac
gcttttagcgtcaatatggtttgtggatcgtctatgaaagctattcaattagcgcatgat
gccatcatgcttgggcgcgatgaggtggtggtgtgcggtggcgtggaaaacatgagcaaa
gcaccctatttgtcatttgacatgcgagacgggaaaagaatggggaatgcgaatatgata
gattccatggtacatgatggattatgggatgctttcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccacatcagccgagaagagcaagataatttcgcgctc
caatcgcaactcaaagcgagagccgccattaatgcaaagaaattccaagaagaaatcacg
cctattgaaatagcgaataaaaaaggcgtggttgtttttaaagaagacgaataccctaga
gacacgacgctagaatcccttgcaaagctcaaacccgctttcaaaaaagacggatcggta
acggcaggaaattcatcagggatcaatgatggcgcgagtattatcattttatgcagcgct
aaaaaagtgcaaacattggggttaaaagccatggccactatcaaggggtttggtttgggt
ggttgcagtccggatataatgggtatatgccctagtattgcgattaaaaacaaccttaaa
aatgtcaaaatgaatctcaatgacatcaatctttttgaactcaatgaagccttcgctgca
caaagcatcgccgtgttaaaagagcttgaattaaaccctaatatcgtgaatgtgaatgga
ggcgcgatagcgattggccaccctattggcgcgagcggcgctaggatattagtcacttta
ttgcatgaaatgaaaaggagcgggcatggtgtgggttgcgcgtcgttgtgcgtgggcggc
ggtcaagggctatcagtggtagtggaacaaaaataa

DBGET integrated database retrieval system