KEGG   Helicobacter pylori India7: HPIN_05480Help
Entry
HPIN_05480        CDS       T01918                                 

Gene name
porD
Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit delta
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
hpn  Helicobacter pylori India7
Pathway
hpn00010  Glycolysis / Gluconeogenesis
hpn00020  Citrate cycle (TCA cycle)
hpn00620  Pyruvate metabolism
hpn00640  Propanoate metabolism
hpn00650  Butanoate metabolism
hpn00680  Methane metabolism
hpn01100  Metabolic pathways
hpn01120  Microbial metabolism in diverse environments
hpn01130  Biosynthesis of antibiotics
hpn01200  Carbon metabolism
Module
hpn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPIN_05480 (porD)
   00020 Citrate cycle (TCA cycle)
    HPIN_05480 (porD)
   00620 Pyruvate metabolism
    HPIN_05480 (porD)
   00640 Propanoate metabolism
    HPIN_05480 (porD)
   00650 Butanoate metabolism
    HPIN_05480 (porD)
  Energy metabolism
   00680 Methane metabolism
    HPIN_05480 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPIN_05480 (porD)
Enzymes [BR:hpn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPIN_05480 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_6 Fer4_10 Fer4_2 Fer4_7 Fer4_9 Fer4_17 Fer4_16 Fer4_15 Fer4_13 Fer4_8 Fer4_4 Fer4_22 Fer4_3
Motif
Other DBs
NCBI-ProteinID: ADU80297
UniProt: E8QH35
Position
1119975..1120367
Genome map
AA seq 130 aa AA seqDB search
MKDWNEFEMGAVLFPFEKNAQSEMEKHNDERHYTEQSYFTTSVAHWRVAKPVHNNNICIN
CFNCWVYCPDAAILSREGKLKGVDYSHCKGCGVCVDVCPTNPKSLWMFEEQIEPATALTQ
WPQKQEKKKS
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattggaacgaatttgaaatgggagcggtgctcttcccttttgaaaaaaacgca
caaagcgaaatggaaaaacacaatgatgagcgccattacaccgagcaaagctacttcacc
acttcagtggctcattggcgcgtggctaagcctgtgcataacaataacatttgcatcaat
tgctttaattgttgggtttattgcccagacgctgccattctttcaagagagggcaaatta
aaaggcgtggattattctcattgtaaaggctgtggcgtgtgtgtggatgtctgccccacc
aaccctaaatcgctatggatgtttgaagaacaaattgagcccgctaccgcactcactcaa
tggccgcaaaaacaagaaaagaaaaaatcataa

DBGET integrated database retrieval system