KEGG   Helicobacter pylori India7: HPIN_07415Help
Entry
HPIN_07415        CDS       T01918                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
hpn  Helicobacter pylori India7
Pathway
hpn00220  Arginine biosynthesis
hpn00330  Arginine and proline metabolism
hpn01100  Metabolic pathways
hpn01110  Biosynthesis of secondary metabolites
hpn01130  Biosynthesis of antibiotics
hpn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpn00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    HPIN_07415
   00330 Arginine and proline metabolism
    HPIN_07415
Enzymes [BR:hpn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     HPIN_07415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ADU80669
UniProt: E8QE13
Structure
PDB: 

Position
1481795..1482763
Genome map
AA seq 322 aa AA seqDB search
MILVGLEAELGASKRGTDKGVRRLREALSATHGDVIKGMQTITQERCVLYKEFRYAKNFE
DYYLFCKENLIPCMKEVFEKKEFPLILSSEHANMFGIFQAFRSVHKDKKIGILYLDAHAD
IHTAYDSDSKHIHGMPLGMVLNRVRSGFNRMSESEEKAWQKLCSLGLEKGGLEMDPKCLV
YFGVRSTEQSERDVIKELQIPLFSVGAIRENMQEVVQKTKESLKAVDIIYLSLDLDIMDG
KLFTSTGVRENNGLSFDELKQLLGLLLESFKDRLGAIEVTEYNPTVSVKHTNEEEKQVLE
ILDLIINSCKIKDKKPSFAMSY
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgattttagtaggattggaagcggaattaggagcgtcaaaaagaggcaccgataaaggg
gttaggcgtttgagagaagctttgagcgccacgcatggcgatgtgattaaaggcatgcaa
acgatcactcaagagcggtgcgtgctttataaagagttcagatacgctaagaattttgaa
gattactaccttttttgtaaagaaaatttgatcccttgcatgaaagaagtgtttgaaaaa
aaagaatttcctttgattttaagctcagagcatgcgaacatgtttgggattttccaggcc
tttaggagcgttcataaggacaaaaaaatagggattttgtatttagacgcgcatgcggat
attcacacggcttatgacagcgattcaaaacatatccacggcatgcctttaggcatggtt
ttaaatcgtgtccgtagcgggtttaatcgcatgagcgagagcgaagaaaaggcatggcaa
aagctctgctcgttggggttagaaaagggagggttggaaatggatcctaaatgtttggtg
tattttggggtaagaagcaccgaacagagcgaaagagatgtgattaaggaattgcaaatc
cctttatttagcgtgggtgcgataagagaaaacatgcaagaagtggttcaaaaaaccaaa
gaatcattaaaagcggtggatattatttatctcagtttggatttagacattatggacggc
aagcttttcacttctaccggcgtgcgtgaaaataacgggctgagttttgatgaattaaag
caattactgggcttgcttttagaaagttttaaagaccgattaggagcgattgaagtaacc
gaatacaaccccacggtgagcgtaaaacacaccaacgaagaagaaaagcaggttttagag
atcttagatctcatcatcaatagctgtaaaattaaagataagaagccatcttttgcaatg
agttactga

DBGET integrated database retrieval system