KEGG   Helicobacter pylori 35A: HMPREF4655_20315Help
Entry
HMPREF4655_20315  CDS       T01892                                 

Gene name
mqo
Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
hpo  Helicobacter pylori 35A
Pathway
hpo00020  Citrate cycle (TCA cycle)
hpo00620  Pyruvate metabolism
hpo01100  Metabolic pathways
hpo01110  Biosynthesis of secondary metabolites
hpo01120  Microbial metabolism in diverse environments
hpo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hpo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HMPREF4655_20315 (mqo)
   00620 Pyruvate metabolism
    HMPREF4655_20315 (mqo)
Enzymes [BR:hpo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     HMPREF4655_20315 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox_2 NAD_binding_8 Pyr_redox_3 Pyr_redox Lycopene_cycl Thi4 PEX-1N FAD_binding_2 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ADU40464
UniProt: E6S4I2
Position
complement(304821..306173)
Genome map
AA seq 450 aa AA seqDB search
MSMEFDAVIIGGGVSGCATFYTLSEYSSLKRVAIVEKCSKLAQISSSAKANSQTIHDGSI
ETNYTPEKAKKVRLSAYKTRQYALNKGLQNEVIFETQKMAIGVGDEECEFMKKRYESFKE
IFVGLEEFDKQKIKELEPNVILGANGIDRHENIIGHGYRKDWSTMNFAKLSENFVEEALK
LKPNNQVFLNFKVKKIEKRNDTYALISEDAEEVYAKFVLVNAGSYALPLAQSMGYGLDLG
CLPVAGSFYFVPDLLRGKVYTVQNPKLPFAAVHGDPDAVIKGKTRIGPTALTMPKLERNK
CWLKGISLELLKMDLNKDVFKIAFDLMSDKEIRNYVFKNMVFELPIIGKRKFLKDAQKII
PSLSLEDLEYAHGFGEVRPQVLDRTKQKLELGEKKICTHKGITFNMTPSPGATSCLQNAL
VDSQEIAAYLGESFELERFYKDLSPEELEN
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgagtatggaatttgatgctgttattattggaggtggggtttcagggtgtgcaaccttt
tatactttgagcgaatacagctctttaaaacgcgtggctatcgtggaaaaatgctctaaa
ttggctcaaatcagctccagtgctaaggctaattcacaaaccattcatgatggctctatt
gaaacgaattacactcccgaaaaagctaaaaaagtgcgtttgagcgcttataaaaccagg
caatacgcgctcaataaaggcttgcaaaatgaagtgatttttgaaacccaaaaaatggct
ataggcgtgggcgatgaagaatgcgagttcatgaaaaaacgctacgaatcctttaaagag
atctttgtggggttagaagaatttgacaaacaaaagattaaagaattagagcctaatgtg
attttaggggctaatggcatagacaggcatgaaaacattatcgggcatggttatagaaag
gattggagcaccatgaattttgcgaagttgagcgaaaacttcgttgaagaagccctaaag
ttaaagcctaacaaccaggtgtttttgaatttcaaagtgaaaaagattgaaaaacgcaac
gacacttacgcgctcatttcagaagacgctgaagaagtgtatgctaaattcgtgctggtc
aatgccggctcttacgctttgcctttggctcagagcatgggttatggcttggatttaggg
tgcttgcctgtggcgggcagcttttattttgtgccggatttattaaggggtaaggtttat
accgttcaaaaccctaaactcccttttgcagccgtgcatggcgaccctgatgccgtcatt
aaaggaaaaacacgaattgggcctaccgctttaacgatgcctaaattagagcgcaataaa
tgttggcttaagggcattagcttggaattgttgaaaatggatttgaataaagatgtgttt
aagattgcgtttgatttgatgagcgataaagaaatccgtaattatgtgtttaaaaacatg
gtttttgaattgcccattattggtaaaaggaagtttttaaaagacgctcaaaaaatcatc
ccctctcttagcctagaagatttagaatatgctcatggttttggcgaagtgcgcccgcaa
gttttagacagaaccaagcaaaagttagaattaggcgaaaaaaagatttgcacccataaa
ggcatcacttttaacatgaccccttctccaggcgcgacgagttgcttgcaaaacgccctt
gtggattcccaagaaatcgctgcgtatttgggcgagagctttgaattagaacgcttttat
aaagatttatccccagaagaactagaaaattaa

DBGET integrated database retrieval system