KEGG   Helicobacter pylori 35A: HMPREF4655_20588Help
Entry
HMPREF4655_20588  CDS       T01892                                 

Definition
(GenBank) pseudouridine synthase, RluA family
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
hpo  Helicobacter pylori 35A
Brite
KEGG Orthology (KO) [BR:hpo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hpo03009]
    HMPREF4655_20588
Enzymes [BR:hpo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     HMPREF4655_20588
Ribosome biogenesis [BR:hpo03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    HMPREF4655_20588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ADU40716
UniProt: E6S584
Position
complement(563840..564721)
Genome map
AA seq 293 aa AA seqDB search
MPFVEEEFEILKPIKALFFVRDVLKCSLKEAQCHLDKQRLKQNQQAVRKSQMIQGVVSLI
HFRPNEKTQALVFETKDFGVFDKPPQVYTHPKGYFYHESLLDCIQSHFGKNAHPAHRLDY
ETSGLVLAGKTLQSAKDLKALFMQKKVKKTYLALVHGLVDRSIVIDKPILTPQNIQKDLR
IKSKISPLGKPSTTLVEPLSYNPFLDISLLKITPITGRTHQIRLHLSSVGHRIVGEGLYG
VIDENAREYLQLKRENNAPLLMLHASSLEFEFKGAIHEITSPMPKRFMPFLKD
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
gtgccttttgttgaagaagaatttgaaattttaaaacccattaaagccttgttttttgtg
cgcgatgttttaaaatgctctttaaaagaagcccagtgccaccttgacaaacaacgcctg
aaacaaaaccaacaagccgtgcgtaaatctcaaatgattcaaggggtcgttagcttgatt
catttcaggcctaatgaaaaaactcaagcgcttgtttttgaaacgaaagattttggcgtg
tttgacaaaccccctcaagtctatacccaccctaaaggctatttttaccatgaaagctta
ctagattgtatccagtcgcattttggcaaaaacgcccacccagcccacagattggactat
gaaacgagcgggttagttttagcgggcaagactttacaaagcgctaaggatttaaaagcg
cttttcatgcaaaaaaaagtgaaaaaaacttatttggcgctagtgcatgggttggttgat
agaagtatcgtcatagacaaacccattctaacgccacaaaacattcaaaaagatttgcgt
attaaatctaaaatttctcctttaggcaagccttcaaccacgcttgttgagcctttaagc
tataacccttttttggatataagcttacttaaaattacccccataaccgggcgcacgcac
cagatccgcttgcatttgagcagcgtgggtcacaggatcgtgggtgaggggctttatggg
gtcatagatgaaaacgctagagaatacctccaattgaagcgtgaaaacaacgccccatta
ctcatgctccatgcctctagtttggaatttgaatttaagggggcgatccatgagatcact
tcccccatgcccaaacgcttcatgccgtttttaaaagattga

DBGET integrated database retrieval system