KEGG   Helicobacter pylori 35A: HMPREF4655_20798Help
Entry
HMPREF4655_20798  CDS       T01892                                 

Gene name
ribA
Definition
(GenBank) GTP cyclohydrolase II
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
hpo  Helicobacter pylori 35A
Pathway
hpo00740  Riboflavin metabolism
hpo00790  Folate biosynthesis
hpo01100  Metabolic pathways
hpo01110  Biosynthesis of secondary metabolites
hpo02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:hpo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    HMPREF4655_20798 (ribA)
   00790 Folate biosynthesis
    HMPREF4655_20798 (ribA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    HMPREF4655_20798 (ribA)
Enzymes [BR:hpo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     HMPREF4655_20798 (ribA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: ADU40916
UniProt: E6S1L4
Structure
PDB: 

Position
770660..771238
Genome map
AA seq 192 aa AA seqDB search
MKRLEVSNQAKLPTQFGEFCIQCFREKGSNGSKDHLVVFTPNFSQNPLVRLHSECLTGDA
LGSQKCDCGGALQIALERISKEGGLVIYLRQEGRGIGLFNKVNAYSLQDKGYDTIQANEM
IGFKDDERDYSIAGEILEYYRIKKMRLLTNNPKKIAALEKYAEVTRESLIVCANEHNQGY
LEVKKLKMGHLL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacgattagaagtttctaaccaagccaaattacccactcaatttggggagttttgt
atccagtgttttagagaaaagggttctaatggctctaaagatcatttagtggttttcacc
cctaatttttctcaaaaccccttagtgcgtttgcattcagaatgcttgaccggcgacgct
ctaggctctcaaaaatgcgattgtgggggggcgttgcaaatagcgttagaaaggatttct
aaagaaggggggctagtgatttatttgcgccaagaagggcgtgggatagggctatttaat
aaagtcaatgcctactctttgcaagataagggctatgataccattcaagccaatgaaatg
atagggtttaaagacgatgaaagggattatagtattgcgggtgaaattttagaatattac
cgcattaaaaaaatgcgcttactcacaaacaaccctaaaaaaatcgccgctttagaaaaa
tacgctgaggtaacaagagagagcttgatcgtgtgcgctaatgagcacaatcaagggtat
ttggaagtcaagaagctcaaaatggggcatttattgtga

DBGET integrated database retrieval system