KEGG   Helicobacter pylori 35A: HMPREF4655_20912Help
Entry
HMPREF4655_20912  CDS       T01892                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hpo  Helicobacter pylori 35A
Pathway
hpo00071  Fatty acid degradation
hpo00072  Synthesis and degradation of ketone bodies
hpo00280  Valine, leucine and isoleucine degradation
hpo00310  Lysine degradation
hpo00362  Benzoate degradation
hpo00380  Tryptophan metabolism
hpo00620  Pyruvate metabolism
hpo00630  Glyoxylate and dicarboxylate metabolism
hpo00640  Propanoate metabolism
hpo00650  Butanoate metabolism
hpo00900  Terpenoid backbone biosynthesis
hpo01100  Metabolic pathways
hpo01110  Biosynthesis of secondary metabolites
hpo01120  Microbial metabolism in diverse environments
hpo01130  Biosynthesis of antibiotics
hpo01200  Carbon metabolism
hpo01212  Fatty acid metabolism
hpo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hpo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HMPREF4655_20912
   00630 Glyoxylate and dicarboxylate metabolism
    HMPREF4655_20912
   00640 Propanoate metabolism
    HMPREF4655_20912
   00650 Butanoate metabolism
    HMPREF4655_20912
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HMPREF4655_20912
   00072 Synthesis and degradation of ketone bodies
    HMPREF4655_20912
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HMPREF4655_20912
   00310 Lysine degradation
    HMPREF4655_20912
   00380 Tryptophan metabolism
    HMPREF4655_20912
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HMPREF4655_20912
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HMPREF4655_20912
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HMPREF4655_20912
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpo04147]
    HMPREF4655_20912
Enzymes [BR:hpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HMPREF4655_20912
Exosome [BR:hpo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HMPREF4655_20912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ADU41017
UniProt: E6S1W5
Position
complement(881886..883088)
Genome map
AA seq 400 aa AA seqDB search
MIDQLKGKDMNEVVVVAAKRSAVGSFLGSLKSVGAREMGAVVLKDALKASTLKPSDVDSV
ILGNVLSAGLGQNIARQIQLDAGIPNDRNAFSVNMVCGSSMKAIQLAHDSIMLGHDEVVV
CGGVENMSAAPYLSFDMRDGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNVAQAYHIS
REEQDTFALQSQLKARVAINAGKFQEEITPIEIANKKGVVVFKEDEYPRETTLESLAKLK
PAFKKDGSVTAGNSSGINDGASIIILCSAQKAQKLGLKTMAAIKGFGLGGCSPDIMGICP
SIAIKNNLKNVKMNLNDINLFELNEAFAAQSIAVLRELELNPNIVNVNGGAIAIGHPIGA
SGARILVTLLHEMKRSGHGVGCASLCVGGGQGLSVIVEQK
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
ttgatagatcaacttaaaggtaaagacatgaatgaagtggttgtagtggcggcaaaacga
agcgctgtggggagttttttaggctctctaaagagcgtgggcgctagagaaatgggtgct
gtcgtgcttaaagacgctctgaaagcgagcactcttaagcctagcgatgtggattctgtc
attttaggcaatgttttaagtgctggtttgggtcaaaatatcgccagacagatccaatta
gatgcgggcataccgaatgacaggaacgcttttagcgtcaatatggtttgtggatcgtct
atgaaagccattcaattagcgcatgacagcatcatgcttgggcacgatgaggtggtggtg
tgcggtggcgtggagaatatgagtgcagccccctatttgtcgtttgacatgcgagatggg
aaaagaatggggaatgccaacatgatagactccatgatccatgacggattgtgggatgcg
ttcaatgattaccacatggggatcaccgctgataatgtcgctcaagcataccacatcagc
cgagaagagcaagatacttttgcgctccaatcgcaactcaaagcaagagtcgccattaat
gcagggaaattccaagaagagatcacgcccattgaaatagcgaataaaaaaggcgtggtt
gtttttaaagaagacgaataccctagagaaacgactctagaatcccttgcaaagctcaaa
cccgctttcaaaaaagatggatcggtaacggcaggaaattcatcagggatcaatgatggc
gcgagtattatcattttatgcagcgctcaaaaagcgcaaaaattggggttaaaaacaatg
gcggctatcaaagggtttggtttgggtggttgcagtccggatataatggggatatgccct
agcatcgctattaaaaacaatcttaaaaatgtcaaaatgaatctcaacgacatcaatctt
tttgaactcaatgaagccttcgccgcacaaagcatagccgtgttaagagagcttgagtta
aaccccaatatcgtgaatgtgaatggaggcgcgatagcgattggccaccctattggcgcg
agcggtgctaggattttggtaaccttattgcatgaaatgaaaagaagtggtcatggcgtg
ggctgtgcgtcattgtgtgtgggcggcggacaagggctatcagtaatagtggaacaaaaa
tag

DBGET integrated database retrieval system