KEGG   Helicobacter pylori P12: HPP12_0050Help
Entry
HPP12_0050        CDS       T00786                                 

Gene name
putA
Definition
(GenBank) proline/delta 1-pyrroline-5-carboxylate dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
hpp  Helicobacter pylori P12
Pathway
hpp00250  Alanine, aspartate and glutamate metabolism
hpp00330  Arginine and proline metabolism
hpp01100  Metabolic pathways
hpp01110  Biosynthesis of secondary metabolites
hpp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hpp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HPP12_0050 (putA)
   00330 Arginine and proline metabolism
    HPP12_0050 (putA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hpp03000]
    HPP12_0050 (putA)
Enzymes [BR:hpp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     HPP12_0050 (putA)
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     HPP12_0050 (putA)
Transcription factors [BR:hpp03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    HPP12_0050 (putA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh
Motif
Other DBs
NCBI-ProteinID: ACJ07210
UniProt: B6JPE9
Position
complement(57593..61150)
Genome map
AA seq 1185 aa AA seqDB search
MQKIIDDSLELAKKLQDSISNHLSEQEKAFHSKMQKLLNNPENKVMLIELMDRSFRCLDN
KARFEMIEHVLDKYKSREIFSPFEKLLLMGFLSFGKMLPDMSVPFFVNKIRSDTKAMVLD
QEESQLKERILKRKNEKIILNVNFIGEEVLGEEEANARFEKYSQALKSNYIQYISIKITT
IFSQINILDFEYSKKEIVKRLDALYALALEEEKKQGMPKFINLDMEEFRDLELTVESFME
SIAKFDLNAGIVLQAYIPDSYEYLKKLHAFSKERVLKGLKPIKIRFVKGANMESEETIAS
VKDWALPTFSSKQDTDSNYNKMLDFVLEGDNYKYIHIGAASHNIFEIAYVYTRIHALNDP
IVLEHFSFEMLEGMSLQASQELKEMHKLILYAPVCDEAHFNNAIAYLVRRLDENTSSDNF
MKAFFNLKVGTSEWKDQEQRFLNSLKGIAALDNATHRTQDRNAKQSGHTTYPNHSFKNES
DTDFILKANREWAKKVREKMHNAPILELYPEIDGRFEDPNLTPLEVFDRIHHKKIASVHL
ADKEAILKALEVAKSDKSHFSQKSFTEIHALLSQTAQLFRERRGDLVGISALEVGKTFAE
TDAEVSEAIDFLEFYPYSLRVLQEQNPKTQFTPKGVGVVIAPWNFPVGISVGTIAAPLAA
GNRVIYKPSSLSSVTGYKLCECFWDAGVPRDALIYLPSKGSDISEHLLKDESIQFAILTG
GEDTAYKMLKANPTLALSAETGGKNATIVSKMADRDQAIKNVIHSAFSNSGQKCSATSLL
VLEKEVYEDENFKKTLIDATLSLSVGDPFDFKNKIGTLADKPNEKVIKAIDELKSYENYE
IPASFVDDNPYLMKPSIKYGTKKGDFTHQTELFTPILSVMEAQDLDEAIEIVNSTGYGLT
SALESLDEREWEYYLERIEAGNIYINKPTTGAIVLRQPFGGVKKSAVGFGRKVGIFNYIT
QFVNIHQEEEDENALKNPLSEALENLTQKGYDEHTHELKRAIFMAKSYAYHYKHEFSQAK
DYVKIRGEDNLFSYTKVKSVGYRITEKDTLSDMLGVALACLVSQIPLTLSIENERTNKDL
TFFLECLKTLQINAPIVYESLQKFSEKLHAFNRVRYLKSDLDLLHKQASALGMVLATAKP
CLNGRFELLYYHLERSVSISYHRYGNLGSRVLRQPTCHKSCCAEK
NT seq 3558 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaatcattgacgattcactagaattagccaaaaaactgcaagatagtatcagt
aaccatttgagcgagcaagaaaaagcgttccactctaaaatgcaaaagcttttaaacaac
cctgaaaacaaagtcatgctcatagagcttatggatcggagttttaggtgtttggataat
aaagcccgctttgaaatgattgagcatgttttagacaaatacaaaagccgtgagattttt
tctccgtttgaaaaattgcttttaatggggtttttaagctttggaaaaatgctccctgat
atgagcgtgcctttctttgtcaataaaatcagaagcgacacgaaagcgatggtcttggat
caagaagagagccagttaaaagagcggattttaaaaagaaaaaatgaaaaaatcattttg
aatgtgaattttattggcgaagaggttttaggcgaagaagaagctaatgcgcgttttgaa
aaatactctcaagccctaaaatccaactacatccaatacatttccattaaaatcacaacg
attttttctcaaatcaatatccttgattttgaatattctaaaaaagagattgtcaaacgc
ctagacgctctttatgccctagctttagaagaagaaaaaaagcaaggcatgccgaaattt
attaatttggatatggaggaatttagggatttagagctcacggtggagtcttttatggaa
tctatcgctaaatttgatttgaacgctggtattgtgttgcaagcctatatccctgattct
tatgaatatttgaaaaaactgcacgctttttctaaagaaagggttttaaaagggttaaag
cccattaaaatccgctttgttaagggagcgaacatggagagcgaagagacgatcgcttcc
gtgaaagactgggcgttacccacattttctagtaagcaagacaccgactctaattacaat
aaaatgttagattttgttttagagggcgataattataaatacattcatatcggcgcagcg
agccataatatttttgaaatcgcttatgtctatacgcgcatccatgcccttaatgaccct
attgtgttggagcatttcagctttgaaatgctagagggcatgagcttgcaagcgagccag
gaattaaaagagatgcacaagctcattctttatgcaccggtgtgcgatgaagcgcatttc
aataatgcgatcgcttacttggtgaggaggttagatgaaaacacctcaagcgataatttc
atgaaagctttcttcaacctcaaagtaggcacgagtgaatggaaagaccaagaacaacgc
ttcttaaacagccttaaaggaatcgctgcgttagacaatgccacccacaggactcaagac
aggaatgctaaacaaagcggccataccacctacccaaaccactcctttaaaaacgaaagc
gataccgattttatcttaaaagccaaccgagaatgggctaaaaaagtgcgcgagaaaatg
cataacgctcctattttagagctttacccagaaatagatgggagatttgaagatcctaat
ctaacccctttagaagtctttgatagaatccatcataagaaaatcgctagcgtgcattta
gcggataaagaagcgattttaaaagccctagaagtggctaaaagcgataagagtcatttc
agtcaaaaaagctttacagaaatccatgctttattgagtcaaaccgcccaactttttaga
gaaagaagaggcgatttagtagggatttcggctttagaagtgggtaagactttcgctgaa
acggacgctgaagtgagcgaagccattgactttttagagttttacccttatagtttaagg
gtgttacaagagcagaacccaaaaacacaattcacccccaaaggcgtgggtgtggtcatt
gccccatggaatttccctgtgggcatttctgtaggcactatcgctgcccccctagccgct
ggcaatcgggtgatttacaagccctcaagtttgtctagcgtaacgggttataagctttgt
gagtgcttttgggatgcgggcgtgcctagagatgcgctcatttacttgccctctaaaggg
agcgatattagcgaacatcttttaaaagatgaaagcatccagtttgccattttaacaggg
ggcgaagacaccgcttataaaatgttaaaagctaaccccactctagccttgagcgctgaa
acgggcggtaaaaacgccaccattgtgagcaaaatggcagacagagaccaggcgattaag
aatgtcatccattcagctttcagcaattcggggcaaaaatgctctgccacttcgctttta
gtgttagaaaaagaagtctatgaagatgagaatttcaaaaagactttgatagatgcgact
ctaagccttagcgtgggcgatccttttgatttcaaaaacaaaattggcactctagcggac
aagcctaatgaaaaggtcatcaaagccatagatgaattgaaaagctatgaaaattacgaa
atcccggcaagctttgttgatgataacccctatttgatgaagccaagcatcaaatacggc
actaaaaaaggcgatttcacgcaccaaactgagctttttacgcccattctatccgtgatg
gaagcgcaagatttagacgaggcgatagaaatagtcaattctaccggttacgggctgact
agcgcgttagagtctttggacgaaagggagtgggaatattatttagaacgcattgaagcc
ggtaatatctatatcaacaaacccaccacaggagcgatcgttttgcgccagccttttgga
ggggttaaaaaatccgctgtggggtttgggaggaaagtaggcatttttaactatatcacg
caatttgtgaatatccatcaagaagaagaagatgaaaacgccttaaaaaaccccttaagc
gaagctttagaaaacttaactcaaaaaggctatgacgaacacacgcatgagttgaagcgc
gcgatttttatggcgaagagctacgcttatcattacaagcatgaattcagccaagctaaa
gactatgtcaaaatcagaggcgaagacaatctcttttcctacactaaagttaaaagcgtg
ggctatcgcatcaccgaaaaggacaccttaagcgacatgttgggcgtggctttagcgtgt
ttagtttctcaaatccctttaacgctcagcatagaaaacgaacgaacgaacaaggattta
acctttttcttagaatgcttgaaaacgctccaaataaacgcccctatcgtttatgaaagc
ttgcaaaaatttagcgaaaaattgcatgctttcaatcgtgtccgttatttaaaaagcgat
ttggatttattgcacaagcaagcgagcgctctagggatggttttagccacggctaaaccc
tgcttgaacgggcgttttgaattgctgtattaccacttagagcgatcggttagcatctct
tatcatcgttatgggaatttaggatcaagggttttaaggcaacccacttgccacaagtca
tgctgtgctgaaaaataa

DBGET integrated database retrieval system