KEGG   Helicobacter pylori P12: HPP12_0305Help
Entry
HPP12_0305        CDS       T00786                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde 2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
hpp  Helicobacter pylori P12
Pathway
hpp00860  Porphyrin and chlorophyll metabolism
hpp01100  Metabolic pathways
hpp01110  Biosynthesis of secondary metabolites
hpp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hpp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HPP12_0305 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hpp01007]
    HPP12_0305 (hemL)
Enzymes [BR:hpp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     HPP12_0305 (hemL)
Amino acid related enzymes [BR:hpp01007]
 Aminotransferase (transaminase)
  Class III
   HPP12_0305 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ACJ07463
UniProt: B6JKN5
Position
320919..322211
Genome map
AA seq 430 aa AA seqDB search
MELLHSINDFNEAKQVIAGGVNSPVRAFKSVKGTPPFILKGKGAYLYDVDNNHYIDFVQS
WGPLIFGHADEEIEENIINTLKKGTSFGAPTELETTLAKEIISCYEGLDKVRLVNSGTEA
TMSAIRLARAYSQKDDLIKFEGCYHGHSDSLLVKAGSGCATFGSPSSLGVPNDFSKHTLV
ARYNDLNSTEECFKKGDVGCVIIEPIAGNMGLVPAQKEFLLGLKALCEKYQAVLILDEVM
SGFRASLSGSQEFYGVVPDLVTFGKVIGAGLPLACFGGRAEIMDLLSPIGGVYQAGTLSG
NPLAVCAGLSALYKIKRDKTLYTRLNALAVRLTQGLKRSAQNYNIALETLNRGSMFGFFF
NENAVCDFDDALKSDTEMFAKFHQKMLFKGVYLACSSFETGFICEPMTEEMIDLVVAKAD
ESFDEIIKGV
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggagttgttgcacagcattaatgattttaatgaagctaagcaggtgatcgctgggggg
gtcaattcacctgtgagggcgtttaagagcgttaaaggcactcccccctttattttaaaa
ggtaagggggcgtatctttatgatgtggataacaaccattatatagattttgtgcaaagc
tgggggcctttgatttttgggcatgctgatgaagagattgaagaaaatattattaataca
ttaaaaaaaggcacttcttttggcgctcccacagaattagaaaccactttagctaaggaa
atcatttcttgttatgaaggcttagataaggtgcgtttagtgaatagcggcacagaagcg
accatgagcgcgatacgactcgctagagcttatagccaaaaagacgatttgatcaagttt
gaagggtgctatcatgggcatagcgactccttattggtgaaagcgggtagcgggtgcgct
acttttggatcgccttcttctttaggcgtgccgaacgattttagcaaacacactctagtg
gctcgttataacgatttaaactccacagaagaatgctttaaaaaaggcgatgtgggttgt
gttatcattgaacccattgctgggaatatggggttagtgccggctcaaaaagagttttta
ttgggcttaaaggctttgtgtgaaaaataccaagcggtgctgattttagatgaagtaatg
agcgggtttagagcgagtttgagcggttcacaagaattttatggtgttgtgccggatttg
gtaacctttggtaaggtgataggcgcggggcttcctttggcgtgttttggggggcgtgcg
gaaattatggacttgctttcgcccattggaggcgtgtatcaagcaggcacattgagcggt
aaccccctagcggtgtgcgcggggttgagtgcgctttataaaatcaaaagagacaaaacc
ctttatacccgcttaaacgctttagccgttcgtttgactcaaggtttaaaaaggagcgct
caaaactataacatcgctttagagacgctcaacagagggagtatgtttggctttttcttt
aacgaaaatgcggtgtgcgattttgatgacgctttaaaaagcgatacagaaatgtttgcg
aaattccaccaaaaaatgctctttaagggcgtgtatttggcatgttcaagctttgaaacc
ggctttatttgtgagcctatgactgaagagatgattgatttggtggttgcaaaggccgat
gaaagttttgatgaaatcataaaaggtgtgtga

DBGET integrated database retrieval system