KEGG   Helicobacter pylori P12: HPP12_0443Help
Entry
HPP12_0443        CDS       T00786                                 

Definition
(GenBank) hypothetical protein
Organism
hpp  Helicobacter pylori P12
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_19 HTH_3
Motif
Other DBs
NCBI-ProteinID: ACJ07599
UniProt: B6JL21
Position
complement(457791..459272)
Genome map
AA seq 493 aa AA seqDB search
MKTYSYNHFLFFCFILGAFLLGLLSPAYALSVITTKEIDANLPNGAIESRVVLGKRVFKV
EAHGFYFRNNATNSIDIEITSLLRDNQSFPLTSPAKTSLKIPPNAKIKKSTILVLRGENA
EEVAKILGISKEEYQKLENTAQTNATNDPMYANTPFNNNPNSPNDNAINGKDGANGSNGY
GINGNDGINGSSGSNGNNSNNNAVGSGIDTDGVLGVDGVNGSNSSSGGSIGGYENNFTNH
GSTNNNTGGYDNFNNNSSSGGSLGNGGLFPIPFGNGDTNNSNNPANTTSPTNGSSSNNAT
NPNSQENNYSSQYCKAPKLSPNNTMKLDVIAKDGSCISMNALRDDTKCAYRYDFEAGKAI
KQTQYYYVDRENKTQTLTPIIDQYYNDPSNPNKQQILNRGIATQLSSQYQEFACGQWEYN
DAKLEAKRPTMLKSYNKLNGEWVEVTPCNFEAGIKSGAVVSPYVMGVSSSKVLSDITTSH
YFKIERKNYGERE
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacttattcatataaccattttttatttttctgctttattctgggagcgttttta
ttaggtttgcttagtccagcttatgctttgagtgttatcaccactaaagaaattgacgct
aatttgcctaatggagcgatagaaagcagggtggtgttaggcaagagggtgtttaaagtg
gaagctcatgggttttattttagaaacaacgcaactaacagcatagatatagaaatcacc
agtcttttaagagacaatcaatcgtttcctttgactagccctgctaaaaccagtttaaaa
atacctcctaacgctaagattaaaaaatccaccatccttgttttaagaggcgagaatgct
gaagaagtggctaagattttaggcattagtaaagaagaataccaaaagctagaaaacacc
gctcaaaccaacgctaccaatgaccctatgtatgctaacacgccttttaataacaaccct
aacagccccaatgataacgctatcaatggtaaagatggtgcaaatgggagtaatggctat
gggataaatggcaacgatgggataaatgggagcagtgggagtaatggaaataattcaaat
aataatgccgtgggcagtggtattgatacagatggcgtgttaggtgtggatggagtgaat
ggatctaactcttcaagcggtggctctatagggggttatgagaataatttcactaatcat
ggctctactaacaataacacaggagggtatgacaattttaataataatagctcaagtggt
gggagtttagggaatggagggcttttccctattccttttggtaatggcgacacaaacaat
tccaataatcccgctaacaccactagcccaactaatggcagtagttctaataacgccact
aatcctaactcgcaagaaaataattattctagccagtattgtaaagcacccaaattaagc
cccaataacacgatgaaactagatgttatcgctaaagatggctcttgtatttctatgaac
gctttaagagatgacactaaatgcgcttatagatacgattttgaagccggtaaggctatc
aagcaaacgcaatactactatgtagatagggaaaataaaacccaaaccttaacgcccata
atagatcagtattacaatgatcccagcaatcctaacaaacaacagattttaaatcgtggg
attgctacccaattaagctcgcaatatcaagaatttgcatgcggtcaatgggaatacaat
gacgctaaattagaagccaaaagacctacaatgttaaaaagctataacaagcttaatggc
gaatgggtagaagttacgccttgtaattttgaagcagggattaaaagcggtgcggttgtt
agcccttatgtgatgggcgtgtctagctctaaagtcttaagcgatattactacaagccat
tattttaagatagaaaggaaaaattatggtgagagggaataa

DBGET integrated database retrieval system