KEGG   Helicobacter pylori P12: HPP12_0449Help
Entry
HPP12_0449        CDS       T00786                                 

Definition
(GenBank) hypothetical protein
Organism
hpp  Helicobacter pylori P12
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACJ07605
UniProt: B6JL27
Position
471523..471807
Genome map
AA seq 94 aa AA seqDB search
MEFKNTKKDRLSDLENRFENANKHETNKHEKEDRKKAHTLYISEKVMNSVEEYLNEFGAF
RENKSVFVQDAIVFYLEHKKKEMKQMLLDKASKL
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atggaatttaaaaacactaaaaaagacaggctaagcgatttagaaaatcgctttgagaat
gccaacaagcatgaaacaaacaagcatgaaaaagaagacaggaaaaaagcccacacgctc
tatatttcagagaaagtgatgaacagcgtagaagagtatttgaatgaatttggagcgttc
agagaaaataaaagcgtgtttgttcaagacgctattgttttttatttagaacacaagaaa
aaagaaatgaagcaaatgcttttagataaggcgagcaagttgtga

DBGET integrated database retrieval system