KEGG   Helicobacter pylori P12: HPP12_0451Help
Entry
HPP12_0451        CDS       T00786                                 

Gene name
virD2-1
Definition
(GenBank) relaxase
Organism
hpp  Helicobacter pylori P12
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF615
Motif
Other DBs
NCBI-ProteinID: ACJ07607
UniProt: B6JL29
Position
complement(473042..474955)
Genome map
AA seq 637 aa AA seqDB search
MALEKSYSKDFESDELFDYEIIKPKKTLKIQYTYAKRYYKEVEKFAKNLTQLTQEEFMRL
REPQKQVVIKNIGNMTRLHSKRAMDYTAKHGELVRDEFFNEVNYNDIAEQWNEQFERILE
KNSRVKNCALHLVFSIDENCNEKNLKALELSVYQTLTNTLGYDYPFIMKLHAHQNNPHAH
VIINKTNKITNKQLRFHSKDSCKEFYHTLRETFKDYLFANSKGELQYSNTPNIYRAIKNI
ETELDALEKQARNNKSFRHENYFYKVLGSATSQIESLKKRENALSDHLDNLKSLLEKTHW
EKENFTPPTNEKELNRQLKEIKWLNKESLTPKKTYKKTQKLVVCKSPLIKDCLYTTKKLF
ATQKKIIDLEKDYKDLKVLKEEFSKDLEVNLSHSKKRFELYTRLKSMSKVFISKSIVKNL
EKIALDFKSDRHSIPQRAFEFFRYMNYQNLSLTNKSNMFLVAKFFKDSALLVNIARFEMK
KIDDSVKNSSPQGNLLDKQVWLNLLEHLKRLEEENYCFAKKRKEFLETRAMELSKDLKFL
TQANENDLPIYERGQRDKIIKRCEKSLNFLQKELQCFKTLSKSASIALENLQNNHQITAV
TQDKQENTNALKKIPLKDFNKTTNEPINPNNNYEMDF
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atggcgttagaaaaaagttatagtaaagactttgaaagcgatgagctttttgattatgaa
atcatcaagcccaaaaagacgcttaagatacaatacacttatgctaaacgctactataaa
gaagtagaaaagtttgctaaaaatttaacccaactgacacaagaagaattcatgcgttta
agagagccacaaaaacaagtggtcatcaaaaacataggcaacatgacacgcttgcattca
aaaagagcgatggattataccgctaaacatggtgagctagtgagagatgaattttttaat
gaagttaattataatgatatagcagagcaatggaatgagcaatttgaaagaatattagaa
aagaatagccgtgttaaaaattgcgctttacatctggtatttagcattgatgaaaattgt
aatgaaaaaaatttaaaagctttggaattaagcgtgtatcaaacactcactaacacgcta
ggttatgattatccttttataatgaaactccatgcacaccaaaacaatccgcatgcgcat
gtgattatcaacaagaccaacaaaattaccaataagcaactacgctttcattctaaagac
agctgtaaagagttttaccacacactaagagaaacatttaaagattatttatttgctaac
tcaaaaggcgaattgcaatattctaacacgcctaatatttatagggcgattaaaaacata
gaaacagagttagatgcactagaaaaacaggctagaaataataagagttttaggcatgaa
aactatttttataaagttttgggcagtgcgacttctcaaatagaaagcttgaaaaaaaga
gaaaatgccctatctgatcatttagataatctaaaaagtttattagaaaaaacacattgg
gaaaaagaaaatttcacgccccctacaaatgaaaaagaacttaataggcaacttaaagaa
ataaaatggttaaataaagagtctttaacccctaaaaaaacttataaaaaaactcaaaaa
ttggttgtctgtaaaagccctttaataaaagattgtctttataccaccaaaaaacttttt
gccacacaaaaaaagattatagatttagaaaaagattataaagatttaaaagtcttaaag
gaagaatttagcaaagatttagaagttaatttatcccattcaaaaaaacgctttgagctt
tacactagactaaagagcatgagcaaagtttttataagcaaaagcattgttaaaaattta
gaaaaaattgctttagattttaaaagcgataggcatagtattccacaaagagcttttgaa
ttttttaggtatatgaattatcaaaatttaagcttgactaataaaagtaatatgttttta
gtggctaagttttttaaagatagcgctttacttgttaatattgctaggtttgaaatgaaa
aagatagatgatagtgttaaaaattctagcccacaaggcaatttattagacaaacaagtt
tggctcaatcttttagaacatttaaaaagacttgaagaggaaaattattgttttgctaag
aaacgaaaagaattcttagaaactagagcgatggagctatcaaaagatttgaaattttta
acgcaagctaatgaaaatgatttacccatttatgaaagagggcaaagggataaaatcatt
aaacgctgtgaaaaatcgcttaattttttacagaaagaattacaatgctttaaaacctta
tcaaaaagtgcaagtatagctttagaaaacttgcaaaataaccatcaaatcacagccgtt
acacaagacaaacaagaaaacacaaacgcgctcaaaaaaataccactcaaagattttaac
aaaaccactaatgaacccataaaccctaacaataactatgaaatggatttttaa

DBGET integrated database retrieval system