KEGG   Helicobacter pylori P12: HPP12_0462Help
Entry
HPP12_0462        CDS       T00786                                 

Gene name
virB10-1
Definition
(GenBank) VirB10 type IV secretion protein
  KO
K03195  type IV secretion system protein VirB10
Organism
hpp  Helicobacter pylori P12
Pathway
hpp03070  Bacterial secretion system
Module
hpp_M00333  Type IV secretion system
Brite
KEGG Orthology (KO) [BR:hpp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    HPP12_0462 (virB10-1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpp02044]
    HPP12_0462 (virB10-1)
Secretion system [BR:hpp02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein [MD:M00333]
   HPP12_0462 (virB10-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbI
Motif
Other DBs
NCBI-ProteinID: ACJ07618
UniProt: B6JL40
Position
complement(480987..482252)
Genome map
AA seq 421 aa AA seqDB search
MGFFRVIRNAPIVSVFIVLMLIFCAWFFLYDDSSPKAVKIYVKGKFPISDYLYKQADEKK
ILPQNNVVKQEIKEERIKKSCKGQITDSKGNLIDDDCNIIATQKQVNNLPNLPKDILKTK
PTVTSNPSNYNTANEEEKTRLVILASRISSQKETQPPTSIKNSVSHTKSKEKQGLEKEYG
SSGFKNFKRKNIASSENKLLRMITADRMIPAILITPISSEIGGSKVVAQVESDIYATMGR
AVLIPKGSRAIGYYNSNNKIGEYRLEIAWNRIITPQGVNIILSDAKGADVKGYNGMIGTL
HNKYWERYGIPLSLSTLSNGLLIGLTSGLTEAMKNKKGGFNQNYFGDYMMMQMTRQTGIS
LNNIIAQIMREQIRIKPIITIREGSHIFISPNTDIWFPIPKNNEVLAKFFNEEKEQNNDT
K
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgggcttttttagagtaattagaaacgcaccgattgtaagtgtctttattgttttgatg
cttattttttgtgcatggtttttcctttatgatgatagctcgcctaaagcagtaaaaata
tatgttaaaggtaagtttccaatctctgactatctctacaaacaagcggatgaaaagaaa
atcctaccacagaacaatgtcgttaaacaagaaattaaagaagaaagaattaaaaaatct
tgtaagggtcagataacagatagtaagggtaatttaatagatgatgattgcaatattata
gccactcaaaaacaagttaataatttaccaaacttaccaaaagatatacttaaaaccaaa
cctactgttacctccaatccttccaactacaataccgctaacgaagaagaaaaaacccgc
ctggtgattttagcgtctcgtattagcagccaaaaagaaacgcagcctccaacctctata
aaaaatagtgtttctcacacaaaatccaaagaaaaacaaggacttgaaaaagaatacggc
tctagcggttttaaaaattttaaaagaaaaaatatagcgagcagtgaaaacaaacttttg
agaatgattacagctgacaggatgatcccagccattctgatcactcctattagcagtgaa
ataggggggagtaaggtagtcgctcaagtggagagtgatatatacgcaacgatgggtaga
gcggttttaatccccaaagggagtagagccataggctattacaactctaataacaaaata
ggagaataccgcttagaaattgcttggaataggataatcacgccacaaggggtcaatatc
atactaagcgatgctaaaggggctgatgtcaagggctataacggcatgataggcacactc
cataacaaatattgggaacgctatggtattcctttatccttaagcaccttgtcaaatggg
ctactcataggtcttactagcggtcttaccgaagcgatgaaaaacaaaaagggtggtttt
aatcaaaactattttggagattacatgatgatgcaaatgacgaggcaaactggtatcagc
ctaaataatattatcgctcaaatcatgcgagagcaaatcaggattaagcccattatcact
attagagaaggaagccatatttttattagtcctaatacggatatttggtttcctatccct
aaaaacaatgaagtcttagcgaaattttttaatgaagaaaaggagcaaaacaatgataca
aaatag

DBGET integrated database retrieval system