KEGG   Helicobacter pylori P12: HPP12_0465
Entry
HPP12_0465        CDS       T00786                                 
Symbol
virB7-1
Name
(GenBank) VirB7 type IV secretion protein
Organism
hpp  Helicobacter pylori P12
SSDB
Motif
Pfam: PIRT
Other DBs
NCBI-ProteinID: ACJ07621
UniProt: B6JL43
Position
complement(484957..485073)
AA seq 38 aa
MRIFLIGIILLALSGCSNKQYEVYKSPCAFFHLNQSIG
NT seq 117 nt   +upstreamnt  +downstreamnt
atgagaatatttttaataggaataattttgttagcactaagtggatgttctaacaaacaa
tatgaagtgtataaaagcccttgtgccttttttcacttaaatcaatccataggctag

DBGET integrated database retrieval system