KEGG   Helicobacter pylori P12: HPP12_0472Help
Entry
HPP12_0472        CDS       T00786                                 

Definition
(GenBank) hypothetical protein
Organism
hpp  Helicobacter pylori P12
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACJ07626
UniProt: B6JL48
Position
complement(491618..491911)
Genome map
AA seq 97 aa AA seqDB search
MQFPLKKDLKISQKYVIPKGFDPTKKEYKNLLVKDLPKLVHREIEIAMGLLFEINEVETA
IEVMKFLTQAMDRVLYDARAKHYEMRLAKEIKKNRFG
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttccactcaaaaaagatttaaaaatttcacaaaaatatgtgatccctaaaggc
tttgacccaacaaagaaagaatacaaaaatcttttggtgaaagatctacctaaattagtg
catagggaaattgaaatcgctatgggattgttatttgaaatcaacgaagtagagaccgcg
attgaagtcatgaaatttctcactcaagcaatggatcgtgttttgtatgatgcgagagcc
aaacattatgaaatgagattagccaaagagattaaaaagaatagatttgggtga

DBGET integrated database retrieval system