KEGG   Helicobacter pylori P12: HPP12_0544Help
Entry
HPP12_0544        CDS       T00786                                 

Gene name
cagM
Definition
(GenBank) cag pathogenicity island protein M
  KO
K12101  cag pathogenicity island protein 16
Organism
hpp  Helicobacter pylori P12
Pathway
hpp05120  Epithelial cell signaling in Helicobacter pylori infection
Module
hpp_M00564  Helicobacter pylori pathogenicity signature, cagA pathogenicity island
Brite
KEGG Orthology (KO) [BR:hpp00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    HPP12_0544 (cagM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpp02044]
    HPP12_0544 (cagM)
Secretion system [BR:hpp02044]
 Type IV secretion system
  Cag pathogenicity island (PAI) protein
   HPP12_0544 (cagM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACJ07698
UniProt: B6JLC0
Position
574409..575539
Genome map
AA seq 376 aa AA seqDB search
MLAKIVFSSLVAFGVLSANVEQFGSFFNEIKKEQEEVAAKEDALKARKKLLNNTHDFLED
LIFRKQKIKELMDHRAKVLLDLENKYKKEKEALEKETRGKILTAKSKAYGDLEQALKDNP
LYKKLLPNPYAYVLNQETFTQEDKERLSYYYPQVKTSSIFKKTTATTKDKAQALLQMGVF
SLDEEQNKKASRLALSYKQAIEEYSNNVSNLLSRKELDNIDYYLQLERNKFDSKAKDIAQ
KATNTLIFNSERLAFSMAIDKINEKYLRGYEAFSNLLKNVKDDVELNTLTKNFTNQKLSF
AQKQKLCLLVLDSFNFDTQSKKSILKKTNEYNIFVDSDPMMSDKTTMQKEHYKIFNFFKT
VVSAYRNNVAKNNPFE
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcaaaaatcgtttttagctcgttggttgcgtttggagttttgtcggctaatgtg
gagcaatttggttcatttttcaacgagataaaaaaagaacaagaagaagtggctgcaaaa
gaagacgctcttaaggctcgcaagaagctcttaaacaatacgcatgatttcttagaagac
ttgatttttagaaaacaaaaaatcaaagagcttatggatcatagagctaaagtcctttta
gacttagagaacaaatacaaaaaagaaaaagaggctctagagaaagagacaagaggtaaa
atccttactgctaagtcaaaggcttatggtgatctagagcaagccttaaaagataaccct
ctctataagaaacttcttcctaacccttatgcctatgttttaaaccaagaaacattcacg
caagaggataaggagcgtttgagttattactaccctcaggtgaaaacaagcagtattttt
aaaaaaactaccgctaccactaaagataaggctcaggctttgcttcaaatgggtgtgttt
tctttagatgaagaacaaaacaaaaaagcgagccgattagctttatcttacaagcaagcg
attgaagaatattccaataatgtttctaatttattgagcagaaaagaattggataatata
gattattacttacagcttgaaagaaacaagtttgactccaaagcaaaagatattgctcaa
aaagctactaacacgcttatttttaactcggaacgcttggcgtttagcatggcgattgat
aagattaatgagaaatacttaaggggctatgaggctttttctaacttgttgaagaatgtc
aaagatgatgtggaattgaatactctgactaaaaactttaccaatcaaaaattgagtttc
gctcaaaaacaaaaattgtgtttgttggttttagacagcttcaattttgatacccaatcc
aaaaaatctatattaaaaaagactaatgaatacaatattttcgtagatagcgatcctatg
atgagcgacaaaacaactatgcaaaaagaacactacaagatatttaatttcttcaaaaca
gtggtttctgcataccgaaacaatgttgccaagaataatccctttgaatag

DBGET integrated database retrieval system