KEGG   Helicobacter pylori P12: HPP12_0701Help
Entry
HPP12_0701        CDS       T00786                                 

Definition
(GenBank) acetyl coenzyme A acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hpp  Helicobacter pylori P12
Pathway
hpp00071  Fatty acid degradation
hpp00072  Synthesis and degradation of ketone bodies
hpp00280  Valine, leucine and isoleucine degradation
hpp00310  Lysine degradation
hpp00362  Benzoate degradation
hpp00380  Tryptophan metabolism
hpp00620  Pyruvate metabolism
hpp00630  Glyoxylate and dicarboxylate metabolism
hpp00640  Propanoate metabolism
hpp00650  Butanoate metabolism
hpp00900  Terpenoid backbone biosynthesis
hpp01100  Metabolic pathways
hpp01110  Biosynthesis of secondary metabolites
hpp01120  Microbial metabolism in diverse environments
hpp01130  Biosynthesis of antibiotics
hpp01200  Carbon metabolism
hpp01212  Fatty acid metabolism
hpp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hpp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPP12_0701
   00630 Glyoxylate and dicarboxylate metabolism
    HPP12_0701
   00640 Propanoate metabolism
    HPP12_0701
   00650 Butanoate metabolism
    HPP12_0701
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HPP12_0701
   00072 Synthesis and degradation of ketone bodies
    HPP12_0701
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HPP12_0701
   00310 Lysine degradation
    HPP12_0701
   00380 Tryptophan metabolism
    HPP12_0701
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPP12_0701
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HPP12_0701
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HPP12_0701
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpp04147]
    HPP12_0701
Enzymes [BR:hpp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HPP12_0701
Exosome [BR:hpp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPP12_0701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ACJ07854
UniProt: B6JLS6
Position
748858..750033
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAVGSFLGSLKNVGAREMGVCVLKDALNASGLKPSDVDSVILGNVLGAG
LGQNIARQIQLDAGIPNDKNAFSVNMVCGSSMKAIQLAHDAIMLGRDEVVVCGGVENMSK
APYLSFDVREGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNVAQAYHISREEQDNFAL
QSQLKARAAINAGKFQEEITPIEIVNKKGVVVFKEDEYPRDTTLESLAKLKPAFKKDGSV
TAGNSSGINDGASIIILCSAKKAQTLGLKAMATIKGFGLGACSPDIMGICPSIAIKNNLK
NVKMNLNDIHLFELNEAFAAQSLAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSGHGVGCASLCVGGGQGLSVVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcagcaaaacgaagcgctgtagggagttttttaggctct
ttaaagaatgtgggcgctagagaaatgggtgtttgcgtgcttaaagacgctttgaatgcg
agcggccttaagcctagcgatgtggattctgtcattttgggcaatgttttaggtgctggt
ttgggtcaaaatatcgccaggcagatccaactggacgctggcatccctaatgacaaaaac
gcttttagcgtcaatatggtttgtggatcgtcaatgaaagccattcaattagcgcatgat
gccatcatgcttgggcgcgatgaggtggtggtgtgcggtggcgtggaaaacatgagcaaa
gcgccctatttgtcgtttgatgtgcgagaggggaaaagaatggggaatgcgaacatgata
gactccatgatccatgatggattgtgggatgcgttcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccacataagccgagaagagcaagataatttcgcgctc
caatcgcaactcaaagcaagagccgccattaatgcagggaaattccaagaagaaatcacg
cctattgaaatagtgaataaaaaaggcgtggttgtttttaaagaggacgaataccctaga
gacacgacgctagaatcccttgcaaagctcaaacccgcttttaaaaaagacggatcggta
acggcagggaattcatcagggatcaatgatggtgcgagtattatcattttatgcagcgct
aaaaaagcgcaaacattgggattaaaagccatggccactatcaaggggtttggtttgggt
gcttgcagtccggatataatgggtatatgccctagcatcgctattaaaaacaaccttaaa
aatgtcaaaatgaatctcaatgacatccatctttttgaactcaatgaagctttcgctgcg
caaagcctagccgtgttaaaagagcttgaattaaaccccaatatcgtgaatgtgaatgga
ggcgcgatagccattggccaccctattggcgcgagtggcgctaggatactggttactctc
ttacacgagatgaagcgtagcggtcatggcgtgggttgcgcgtcattgtgcgtgggtggc
ggtcaagggctatcagtggtagtggaacaaaaataa

DBGET integrated database retrieval system