KEGG   Helicobacter pylori P12: HPP12_0703Help
Entry
HPP12_0703        CDS       T00786                                 

Gene name
scoB
Definition
(GenBank) succinyl-coa-transferase subunit B
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
hpp  Helicobacter pylori P12
Pathway
hpp00072  Synthesis and degradation of ketone bodies
hpp00280  Valine, leucine and isoleucine degradation
hpp00650  Butanoate metabolism
hpp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    HPP12_0703 (scoB)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    HPP12_0703 (scoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HPP12_0703 (scoB)
Enzymes [BR:hpp01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     HPP12_0703 (scoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-ProteinID: ACJ07856
UniProt: B6JLS8
Structure
PDB: 

Position
750739..751362
Genome map
AA seq 207 aa AA seqDB search
MREAIIKRAAKELKEGMYVNLGIGLPTLVANEVSGMNIVFQSENGLLGIGAYPLEGGVDA
DLINAGKETVTVVPGASFFNSADSFAMIRGGHIDLAILGGMEVSQNGDLANWMIPKKLIK
GMGGAMDLVHGAKKVIVIMEHCNKYGESKVKKECSLPLTGKGVVHQLITDLAVFEFSNNA
MKLVELQEGVSLDQVKEKTEAEFEVHL
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgagagaggctatcattaaaagagcggcaaaggaattaaaagagggcatgtatgtgaat
ttagggataggcttgcccacgcttgtggctaatgaagtgagcgggatgaatatcgttttc
caaagcgagaacgggctattagggattggtgcttaccctttagaagggggcgttgatgcg
gatcttatcaacgcaggaaaggaaaccgtaaccgtggtgccgggcgcttcgtttttcaat
agtgcggattcgtttgcgatgattcgtggggggcatattgatttagcgattttagggggg
atggaagtctcacaaaatggggatttggctaattggatgatccctaaaaagctcataaaa
ggcatgggaggggctatggatctggtgcatggcgctaaaaaagtgattgtcatcatggag
cattgcaacaaatacggggagtctaaagtgaaaaaagaatgctccttacccctaacagga
aagggcgtggtgcatcaattgataacggatttagcggtgtttgagttttccaataacgcc
atgaaattagtggaattgcaagagggggtcagcctcgatcaagtgaaagaaaaaacagaa
gctgaatttgaagtgcatctatag

DBGET integrated database retrieval system