KEGG   Helicobacter pylori 2017: hp2017_0198Help
Entry
hp2017_0198       CDS       T01913                                 

Gene name
tpiA
Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hpq  Helicobacter pylori 2017
Pathway
hpq00010  Glycolysis / Gluconeogenesis
hpq00051  Fructose and mannose metabolism
hpq01100  Metabolic pathways
hpq01110  Biosynthesis of secondary metabolites
hpq01120  Microbial metabolism in diverse environments
hpq01130  Biosynthesis of antibiotics
hpq01200  Carbon metabolism
hpq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    hp2017_0198 (tpiA)
   00051 Fructose and mannose metabolism
    hp2017_0198 (tpiA)
   00562 Inositol phosphate metabolism
    hp2017_0198 (tpiA)
Enzymes [BR:hpq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     hp2017_0198 (tpiA)
Exosome [BR:hpq04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   hp2017_0198 (tpiA)
  Exosomal proteins of bladder cancer cells
   hp2017_0198 (tpiA)
  Exosomal proteins of melanoma cells
   hp2017_0198 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADZ49279
Position
192032..192736
Genome map
AA seq 234 aa AA seqDB search
MTKIAMANFKSAMPVFKSHAYLKELEKTLKPQHFDRVFVFPDFLGLLPNAFLHFTLGAQN
AYPRDCGAFTGEITSKHLEELKIHTLLIGHSERRALLKESPSFLKEKFDFFKGKNFKIVY
CIGEELMTREKGLVAVKEFLSEQLGTIDLNYSNLIVAYEPIWAIGTKKSASLEDIYLTHG
FLKQILNQKTPLLYGGSVNIQNAKEILGIDSVDGLLIGSASLELENFKTIISFL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattgccatggctaatttcaaatccgctatgcctgtttttaaaagccatgcg
tatttaaaagaattggaaaaaactttaaagccgcagcattttgatagggtgtttgtattc
cctgattttttggggttattgcctaatgcgtttttgcatttcactttaggagcgcaaaac
gcttaccctagagattgtggggcttttaccggtgaaatcacttccaagcatttagaagaa
ttaaaaatccacacgcttttaatagggcatagcgagaggcgagcgcttttaaaggaaagc
cctagctttttgaaagaaaagtttgatttttttaaaggtaaaaattttaaaattgtctat
tgcattggcgaagaattgatgaccagagaaaagggtttagtggctgtaaaggaattttta
agcgagcaattaggaactattgatctcaattattccaatttgattgtggcttatgagcct
atttgggcgattggcaccaaaaaaagcgcgtctttagaagatatttacctcacgcatggt
tttttaaagcaaatcttaaatcaaaaaacgcccttattgtatggggggagcgtgaatata
caaaacgctaaagaaattttagggattgatagcgtggatggcttattgatcgggagcgcg
tctttggaattagaaaattttaaaacaatcatttcatttttataa

DBGET integrated database retrieval system