KEGG   Helicobacter pylori 2017: hp2017_0684Help
Entry
hp2017_0684       CDS       T01913                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase/Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hpq  Helicobacter pylori 2017
Pathway
hpq00071  Fatty acid degradation
hpq00072  Synthesis and degradation of ketone bodies
hpq00280  Valine, leucine and isoleucine degradation
hpq00310  Lysine degradation
hpq00362  Benzoate degradation
hpq00380  Tryptophan metabolism
hpq00620  Pyruvate metabolism
hpq00630  Glyoxylate and dicarboxylate metabolism
hpq00640  Propanoate metabolism
hpq00650  Butanoate metabolism
hpq00900  Terpenoid backbone biosynthesis
hpq01100  Metabolic pathways
hpq01110  Biosynthesis of secondary metabolites
hpq01120  Microbial metabolism in diverse environments
hpq01130  Biosynthesis of antibiotics
hpq01200  Carbon metabolism
hpq01212  Fatty acid metabolism
hpq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hpq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    hp2017_0684
   00630 Glyoxylate and dicarboxylate metabolism
    hp2017_0684
   00640 Propanoate metabolism
    hp2017_0684
   00650 Butanoate metabolism
    hp2017_0684
  09103 Lipid metabolism
   00071 Fatty acid degradation
    hp2017_0684
   00072 Synthesis and degradation of ketone bodies
    hp2017_0684
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    hp2017_0684
   00310 Lysine degradation
    hp2017_0684
   00380 Tryptophan metabolism
    hp2017_0684
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    hp2017_0684
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    hp2017_0684
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    hp2017_0684
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpq04147]
    hp2017_0684
Enzymes [BR:hpq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     hp2017_0684
Exosome [BR:hpq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   hp2017_0684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADZ49779
Position
complement(698739..699914)
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAVGSFLGSLKNVGARQMGVSVLKDALNASSLKPSDVDSVVLGNVLGAG
LGQNIARQIQLDAGIPNDRNAFSVNMVCGSSMKAIQLAHDSIMLGRDEVVVCGGVENMSA
APYLSFDMREGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNVAQAYHISREDQDAFAL
QSQLKARAAINAGKFQEEITPIEIASKKGVVVFKEDEYPRDTTLESLAKLKPAFKKDGSV
TAGNSSGINDGASIIILCSAKKAQKLGLKTMATIKGFGLGGCSPDIMGICPSIAIKNNLK
NAKMNLNDINLFELNEAFAAQSIAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSGHGVGCASLCVGGGQGLSVVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcggcaaagcgtagcgctgtagggagttttttaggctct
ctaaagaatgtgggcgctaggcaaatgggcgttagcgtgcttaaagacgctttgaacgcg
agctctcttaagcctagcgatgtggattctgtcgttttaggcaatgtcttaggcgctggt
ttgggtcaaaatatcgccagacagatccaactagacgccggtatccctaatgacagaaac
gcttttagcgtcaatatggtttgcggatcatctatgaaagctattcagttagcgcatgac
agcatcatgcttgggcgcgatgaagtggtggtgtgcggtggcgtggaaaacatgagcgca
gcgccttatctgtcgtttgacatgcgagaggggaaaagaatggggaatgcgaacatgata
gattccatgatacatgacggattgtgggatgcgttcaatgattaccacatggggatcact
gctgataatgtcgctcaagcataccacataagccgagaagatcaagacgcattcgcgctc
cagtcgcaactcaaagcgagagccgccatcaatgcagggaaattccaagaagaaatcacg
cctattgaaatagcgagtaaaaaaggcgtggtggtttttaaagaagacgaataccctaga
gacacgacgctagaatcccttgcaaagctcaaacccgctttcaaaaaagacggctcggta
acggcaggaaattcatcagggatcaatgatggcgcgagcattatcattttatgcagcgct
aaaaaagcgcaaaaattggggttaaaaacaatggccactatcaaggggtttggtttgggt
ggttgtagtccggatattatgggcatatgcccaagcatcgctattaaaaacaatcttaaa
aatgccaaaatgaatctcaatgacatcaatctttttgaactcaatgaagcctttgccgct
caaagcatcgccgtgctaaaagagcttgaattaaaccctaatatcgtgaacgtgaatgga
ggcgcgatagcaattggccaccctattggcgcgagcggcgctagaatcttagtgacttta
ttgcatgaaatgaaaagaagcgggcatggcgtgggttgcgcgtcattgtgcgtgggtggc
ggtcaagggctatcagtggtagtggaacaaaaataa

DBGET integrated database retrieval system