KEGG   Helicobacter pylori 2017: hp2017_1052Help
Entry
hp2017_1052       CDS       T01913                                 

Definition
(GenBank) Glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
hpq  Helicobacter pylori 2017
Pathway
hpq00030  Pentose phosphate pathway
hpq00480  Glutathione metabolism
hpq01100  Metabolic pathways
hpq01110  Biosynthesis of secondary metabolites
hpq01120  Microbial metabolism in diverse environments
hpq01130  Biosynthesis of antibiotics
hpq01200  Carbon metabolism
Module
hpq_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:hpq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    hp2017_1052
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    hp2017_1052
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpq04147]
    hp2017_1052
Enzymes [BR:hpq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     hp2017_1052
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     hp2017_1052
Exosome [BR:hpq04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   hp2017_1052
  Exosomal proteins of colorectal cancer cells
   hp2017_1052
  Exosomal proteins of bladder cancer cells
   hp2017_1052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ADZ50162
Position
1072074..1073351
Genome map
AA seq 425 aa AA seqDB search
MLDFDLVLFGATGDLAMRKLFVSLYEIYIHYGFKNDSRIIASGRKELSNEEFLMLLCEKT
QLHSREKGKEFLAHISYLRVRLDNPKDFEELSKIATNNKPLIFYFSISPSFFATTAQNLA
QNALNHANTRLILEKPLGHDLKTCQEIFQSISAFFKEEQIFRIDHYLGKKGVQNILELRL
NNPILNILWDQISAVEICVYETLGVEERGEFYDKIGALRDMVQNHLLQVLSLIATDLPND
LKDLRQEKIKVLKTLQPPKDFKKQVIRAQYQGYRDENKVNKESQTETFVAIKAFLDTPKF
KGVPFYLKHAKKMPRNQASVKIHFNAVNTLEFFLSQDKITLTLKDHQNPLILETHNKQEF
LQPYAKLLYDAIQNNHNNFAHQLELEASWVFIDTLIEGFMNNATPLYSYESHNLNESEFL
KPLYQ
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgctggattttgatttggttctttttggtgcgactggggatttagccatgcgaaagctc
tttgtttcgctctatgaaatttatattcattatggttttaaaaacgattctaggattatc
gcatcagggcgtaaggagctatccaatgaagagtttttgatgcttctttgtgaaaagaca
caactgcattcaagagaaaagggtaaggaatttttagcccatatcagttatttgcgcgtc
cgtttggataaccctaaagactttgaagaattgagtaaaatcgctacaaacaataagccc
ttgatcttctacttttctatctcccctagtttttttgcaacgaccgctcaaaatttagcc
caaaacgcgctcaatcacgccaacactcgcttgattttagaaaaacccttagggcatgat
ttaaagacttgtcaagagattttccaaagcattagtgctttttttaaagaagagcaaatc
tttagaatcgatcattatttagggaaaaagggcgttcaaaatatccttgaattgcgcttg
aataaccctatcttaaacattttatgggatcaaatcagtgcggttgaaatctgcgtgtat
gagactttgggggtggaagaaaggggcgaattttacgataaaatcggggctttaagggat
atggttcaaaaccatctcttgcaagttttatcccttatcgctacagatttacccaacgat
ttaaaagacttgaggcaagaaaaaatcaaagttttaaaaaccttacaaccccccaaagat
ttcaaaaaacaggttattcgggcccaatatcaaggctatagagatgaaaataaagtcaat
aaagagagccagacagagacttttgtcgctattaaagcctttttggatacgcctaaattt
aaaggcgtgcctttctatcttaagcacgctaaaaaaatgccccgcaatcaagcgagcgtg
aaaatccattttaacgcagtcaatacgctagaatttttcctctctcaagataaaatcact
ctcaccctaaaagatcatcaaaacccccttattttagaaacccacaacaaacaagaattt
ttacagccctacgctaaattgctctatgatgcgatacaaaataaccacaataatttcgcc
caccagctggaattagaagcgtcatgggtttttattgacacgcttatagagggctttatg
aataacgccacacccttatattcctatgaaagccacaatctcaacgaatcagaattttta
aaaccactctatcaataa

DBGET integrated database retrieval system