KEGG   Helicobacter pylori 2017: hp2017_1469Help
Entry
hp2017_1469       CDS       T01913                                 

Gene name
rocF
Definition
(GenBank) Arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
hpq  Helicobacter pylori 2017
Pathway
hpq00220  Arginine biosynthesis
hpq00330  Arginine and proline metabolism
hpq01100  Metabolic pathways
hpq01110  Biosynthesis of secondary metabolites
hpq01130  Biosynthesis of antibiotics
hpq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    hp2017_1469 (rocF)
   00330 Arginine and proline metabolism
    hp2017_1469 (rocF)
Enzymes [BR:hpq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     hp2017_1469 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase Tfb2_C
Motif
Other DBs
NCBI-ProteinID: ADZ50593
Position
complement(1478029..1478997)
Genome map
AA seq 322 aa AA seqDB search
MILVGLEAELGASKRGTDKGVRRLREALSETHGDVIKGMQTIIQERCVLYKEFRYAKNFE
DYYLFCKENLIPCMKEVFEKKEFPLILSSEHANMFGIFQAFRSVHKDKKIGILYLDAHAD
IHTAYDSDTKHIHGMPLGMVLNRVHSGVNHMNESEEKAWQKLCSLGLEKGGLEIDPKCLV
YFGVRSTEQSERDVIKELEIPLFSVDAIRENMHEVVQKTKELLKAVDIIYLSLDLDIMDG
KFFTSTGVRENNGLSFDELRQLLGLLLENFKDRLGAVEVTEYNPTVSTKHTDEEEKQVLE
ILDLIINRCKIKDKERSFAMSS
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgattttagtaggattagaagcggagttaggagcgtcaaaaagaggcaccgataaaggg
gttaggcgtttgagagaggctttaagcgaaacgcatggcgatgtgattaaaggcatgcaa
acaatcattcaagagcggtgcgtgctttataaggagtttagatacgctaagaattttgaa
gattactaccttttttgtaaagaaaatctgatcccttgcatgaaagaagtgtttgagaaa
aaagaattccctttgattttaagctcagagcatgcgaacatgtttgggattttccaagcc
tttaggagcgttcataaagacaaaaaaatagggattttgtatttggacgcgcatgcggat
attcacacggcttatgacagcgatacaaagcacattcatggcatgcctttaggcatggtt
ttaaatcgtgtccatagcggggttaatcatatgaatgagagtgaagaaaaggcatggcaa
aagctctgctctttggggttggaaaaaggggggttagaaattgatcctaaatgtttggtg
tattttggggtaagaagcacagaacagagcgaaagagatgtgattaaggaattagaaatc
cctttatttagcgtggacgcgataagagaaaacatgcatgaagtggttcaaaaaaccaaa
gaattgttaaaagcggtggatattatttaccttagcttggatttagacattatggatggt
aagtttttcacttctaccggcgtgcgtgaaaataacgggctgagttttgatgaattaagg
caattactgggtttgcttttagaaaattttaaagaccgattaggggcggttgaggtaacc
gaatacaaccccacggtgagcactaaacacaccgatgaagaagaaaagcaggttttagaa
atcctggatctcatcatcaatcgctgcaagattaaagacaaggagcgatcttttgcaatg
agtagctga

DBGET integrated database retrieval system