KEGG   Haemophilus parainfluenzae: PARA_04970Help
Entry
PARA_04970        CDS       T01605                                 

Definition
(GenBank) uroporphyrinogen III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hpr  Haemophilus parainfluenzae
Pathway
hpr00860  Porphyrin and chlorophyll metabolism
hpr01100  Metabolic pathways
hpr01110  Biosynthesis of secondary metabolites
hpr01120  Microbial metabolism in diverse environments
Module
hpr_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:hpr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PARA_04970
Enzymes [BR:hpr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PARA_04970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: CBW14604
UniProt: E1W2L6
Position
492847..493611
Genome map
AA seq 254 aa AA seqDB search
MAVLVTRPDERGKALVDQLNQAGVVALHLPLLSIEAGAELAQLPTKLNQLKSGDYVFLVS
KSAVDFADKTLKDIGFSWRQDLQYFTVGHRTAQHFSCQTECTVRYPITSENTEGVLNLPQ
MAELTDKNLLILRGNGGRELLREQTTLRGATVETVECYQRTPISYNNEEQTSICIRSGVQ
TLVVTSLEILQALIEFVPENEQNWLKNCCLVTVSQRIADVAIQQGWHNVVVSAGADNQSL
LNTLLLNEVTPLSH
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggccgtactagtcactcgcccagatgaacgaggaaaagccctcgttgatcagctgaat
caagccggtgtggttgccttgcatttgcctttgctttctattgaggcgggtgctgagttg
gcacaattaccaacgaaacttaatcagctaaaaagtggtgattatgtgtttttggtatcc
aaaagtgcggtcgattttgcggataaaaccctgaaagatattggctttagctggcgtcaa
gatttacaatactttacagttggacatagaacggcacagcatttttcctgtcaaactgaa
tgtactgttcgttatccaatcacgtcggaaaatactgaaggcgtactaaatttaccgcaa
atggcagaattaacagataaaaacttgttaattttacgcggcaacggtggacgagaatta
ttacgcgaacagaccacactacgcggcgcaactgttgagacagtcgaatgttaccaacgc
acgccgattagttataataacgaagagcaaaccagtatttgtattcgttctggcgtgcaa
acccttgtggtaacaagccttgaaattttgcaggcgttaatcgaatttgtacctgaaaat
gaacaaaattggctaaaaaattgctgtttagtcacggtaagtcaacgcattgcggatgtt
gcaatacaacaaggttggcataatgtggtggtttccgccggtgcggacaatcaaagttta
cttaataccttacttcttaatgaagtaactcccctttctcactaa

DBGET integrated database retrieval system