KEGG   Haemophilus parainfluenzae: PARA_11840
Entry
PARA_11840        CDS       T01605                                 
Name
(GenBank) unnamed protein product
Organism
hpr  Haemophilus parainfluenzae
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG FtsK_SpoIIIE AAA_29 AAA_10 AKAP7_NLS T2SSE DUF87 ResIII AAA_22
Other DBs
NCBI-ProteinID: CBW15289
UniProt: E1W4J7
Position
complement(1181099..1183969)
AA seq 956 aa
MALFQDVLEAFFPAKKGDKPQPKKEPILTSIAPEEAQPDDTNNVEEAIEITPVMRNRKMT
REQHVKMLYGRDPSFISNLPYAEYLEEEGVMLFDDAKSAGAVFDIKPIGTEGRSSDYLNR
VRTLVKDALQDSFDELDTNPYVVQFYCQDDKDLSGYVENLRQYIKTTSPEASGSAFTEQW
LGEMERHLKAVGKPGGLFVDDRVTSTAWAGKVRKTRMVIYRYAGNNETDTIEKLNTACDR
VQSAFITAGLTMERQNETQIHRWLLEWFNPNPSRYFNGLDDKACYDLLSLSKDESALPLQ
DQDFSENLFFTPPESKNGYWYFNEQPHEVIVVDNIRKQPDVGHMTGEVTRGRNINALFDL
LPESTIMAITVVIHPQDKLQAHLDKLSSRAVGNNYESIYLKQDALTVTEYLKDGHKLYQA
GMVFYVRGKDDQELRIRSRELRTVLLSNNLVPVKEGNEVAPLNSYLRWLPMNFNPQLDAK
SRFYTKYYWVQHIANMLPVFGRETGTGHPGITYFNRGGSPLDFDPLNPKDRTKNAHKLIL
GPTGSGKSATLTAQMAQLMAVHRPRLFIVEAGNSFGLFSDYAERYGLTVNRVSLEPSSNI
ALPLFSEAHRLLEMDIDLEVQDDDDNEDEGEEQRDLLAEMELTARLMITGGEAKEDEKMS
RADRSAIRQAILLAAEKTSQETPPRQVLTGDVKAALEELSHRPDIRPERASRLADMAEAM
DIFCTGVNGRFFNREGEIWPEADITLVDLAMFARDGYEAELAISYISLINHINSLGEKYQ
HSFRPIVNITDESHIITVNPLLAKFLVKGSKMWRKLGIWLWLATQNMADFPDESDKLLSM
VEWWELLNLSNDEVEQVNRFRRLSEAQKMMLLSAKKADKKYTEGVVLATNMEALFRVVPP
SLYLALGMTEKHEKAQRKQLMMEHNCTELDAALMVAKDLDKKRGIAVNDELNSIAA
NT seq 2871 nt   +upstreamnt  +downstreamnt
atggcattatttcaagacgtgttagaggctttcttcccggctaaaaagggtgataagcct
caacctaaaaaggaacctatcctaacatccattgcaccggaagaagcacagccggatgat
accaataacgtagaagaggcgattgaaatcactcctgttatgcgtaatagaaaaatgacc
agagagcaacatgttaaaatgctttatgggcgcgatccctcttttatttccaaccttcct
tatgcggaatatttggaagaagaaggcgtaatgctttttgatgatgctaaaagtgcgggt
gcagtatttgatattaaacctataggaaccgaggggagaagtagcgattatcttaatcgt
gttcgcacgttggttaaagatgctttacaagatagtttcgatgaacttgataccaatcct
tacgtcgtacaattctattgtcaggatgataaggatttaagcggttatgttgagaatctg
agacagtatattaaaaccacttcacctgaagcgagcggtagtgcgtttacagaacagtgg
cttggtgaaatggagcgtcacttaaaagcagtaggtaaaccaggtgggctttttgttgat
gaccgggtaacaagtacggcatgggctggaaaagtgcgtaaaacacgcatggttatttat
cgttatgctggaaataatgagacagatacaatcgagaaattaaatacagcttgtgatcgt
gttcaaagtgcttttatcacagctggattaaccatggagcgccaaaatgaaacacaaatt
catcgttggttattagaatggtttaatccaaatccatcacgctattttaacggactcgat
gacaaagcttgctatgatcttttatcactctctaaagatgagtccgctctaccattacaa
gaccaagattttagtgaaaatctcttttttacgccaccggaaagtaaaaatggctattgg
tattttaatgagcaacctcacgaagtcattgtagttgataatattcgtaagcagccggat
gttggccacatgacaggcgaagtcactcgaggtcgtaatattaatgcactatttgattta
ttgccggaatcaaccattatggctatcactgtagtcattcatcctcaagataaattacag
gcgcatttagataaattaagtagtcgagctgtcggtaataactatgagtctatctattta
aaacaagatgccctcacagtgactgaatatttaaaagacggacacaagctttatcaagct
ggcatggttttctatgtaagagggaaagacgatcaagagctacgcattcgctcaagagaa
ttaagaacggttttactcagtaataatttagtgccggtaaaagaaggtaacgaagttgcg
cctcttaatagctatttacgctggctaccgatgaattttaatcctcaattagatgcaaaa
tctcgtttttataccaagtattattgggtgcaacacattgcgaatatgttacctgtattt
ggccgtgagacaggaacgggacacccagggatcacctattttaaccgcggtggaagccca
ttagattttgacccactaaaccctaaagaccggactaaaaatgcgcataagctcatttta
ggccctacaggttcaggtaaatcggcaacattaaccgcacaaatggcgcaactgatggct
gtgcaccgtcctcgcttgtttattgtagaagcgggtaactcttttggattgttttcagat
tatgcggagcgttacggtttaacggttaaccgggtatctcttgagccaagtagtaacatc
gctttaccgctcttctctgaagcgcatcgtttattggaaatggatatcgatcttgaagtt
caagatgatgacgataatgaagatgaaggcgaggaacaacgagacttacttgcggaaatg
gaattaactgcacgcttaatgatcaccggtggcgaagcgaaagaggatgagaaaatgagt
cgtgctgaccgctctgccattcgccaggctattttattagctgcggagaaaacctcacaa
gaaaccccgcctcgtcaagtattaaccggggatgttaaagccgcacttgaggaattaagc
catcgcccggatattcgtcctgagcgcgcatctcgccttgctgatatggctgaagcgatg
gatattttctgtaccggggtaaatggtcgattctttaaccgtgaaggggaaatttggcca
gaggctgatattacactcgtcgatttggcgatgtttgcacgtgatggctatgaagctgaa
ttagcgatttcgtatatttccctaattaaccatatcaactccttaggtgaaaaatatcaa
cacagtttccgccctatcgtgaacattacggatgagtcgcatatcattaccgtaaatcca
cttctagcgaagttcctggttaaaggttctaaaatgtggcgtaaattgggtatttggtta
tggttggctacacagaatatggctgacttccctgatgaatctgataaattactcagcatg
gttgaatggtgggaattacttaacctttctaatgatgaagtcgaacaggtaaaccgtttc
cgtcgtttatctgaagctcagaaaatgatgttgttatctgcaaaaaaagcagataagaaa
tatactgaaggtgtggtgctcgcaaccaatatggaagccttattccgtgttgttccacct
agtctttacttagcactagggatgactgaaaaacacgagaaagcacaacgtaaacaatta
atgatggaacataactgtactgagttagatgcggcattgatggttgctaaagacttagac
aaaaaacgggggattgcagtcaatgacgaacttaactcaatcgcagcctaa

DBGET integrated database retrieval system