KEGG   Haemophilus parainfluenzae: PARA_11860
Entry
PARA_11860        CDS       T01605                                 

Definition
(GenBank) putative exported protein precursor
Organism
hpr  Haemophilus parainfluenzae
SSDB
Motif
Pfam: TrbI Mod_r DUF4347 BshC Seryl_tRNA_N HALZ GldM_N
Other DBs
NCBI-ProteinID: CBW15291
UniProt: E1W4J9
Position
complement(1184402..1185802)
AA seq 466 aa
MQMKANKAFYVIGGITALVVTLMAGFLFSGSSSTTTAETKKEDALDLSLKDLSPEELRSM
GLEGDTSKDTVRTLIGKVKENNKRFDEVILQNDRLVKENEQLKNQANNTDYQIQQAVQAE
TGALINEINALKDQVVQAGNQVVGNGNAQANPNAPLPINGATTGPQVETRGGINWVNPSD
MPTTDSQGNALQGIGVNGAGIGFPKTFDNNVNDIRKSNDGLQSSTGNNAIFNTATPFFTI
AANSTLTNSVAMTALVGRVPIDNNVTEPYPFKLLIGRDNLIANGIELPDIEGAIVSGTAS
GDWTLSCVRGDVKSLTFVFSDGRIVSTDDSNNKIGWLSDPHGVPCIPGERRTNAPEYLTT
NFFLTGASAAAQGLSSSQSTTVVDGGAVIGAVTGNNGKYILGQALGGGLRETADWFRQRY
GQMFDAVYVPPGKEVAVHIEKQIDIDYDRMSRKVKYGQASRQSNLD
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgcaaatgaaagcaaataaagcgttctatgttattggtgggattaccgcgcttgtcgtg
acgctgatggctggatttcttttctccggtagtagctcaacaactacagcagaaaccaaa
aaagaagatgctttagatctctctctcaaagatttatcaccggaagagctacgctcaatg
gggcttgagggtgatacatctaaagatacggtgagaacacttattggtaaagtgaaggaa
aataacaaacgctttgatgaagtgattttacaaaatgaccgcttggtaaaagagaatgag
cagttaaaaaatcaagcaaataatacggattatcaaattcaacaggcggtacaagcagaa
acaggggcgttaattaatgagattaatgcgttaaaagatcaggttgtacaagctggtaat
caagttgtagggaatggaaatgcccaggcaaatcccaatgctcctctaccaataaacgga
gcaacaactggccctcaggttgaaactcgagggggaattaattgggtgaaccctagtgat
atgccaactacagacagccaagggaatgctctacaaggtattggtgtaaatggtgcagga
atcggttttcccaaaaccttcgataacaatgtgaatgacatccgaaaatcgaatgatggg
ttgcaatctagtaccggtaataatgcaatatttaataccgctacaccatttttcacaatt
gcagctaactctaccttaactaattctgttgcaatgactgcgcttgttgggcgtgtgccg
attgataataatgtgaccgagccttatccgtttaaattgcttatcggtcgagataactta
attgcaaatggtattgaactgccggatattgaaggcgcaattgtctctggaaccgcaagc
ggtgactggacgctatcttgtgtacgtggtgatgtgaaaagcttaacttttgtatttagc
gatgggcgcattgtttcaacggatgattctaacaataaaattggctggttatctgatccg
cacggtgtgccttgcattcctggagaacgcagaacgaatgctccggaatatctaacaacc
aactttttcttaacgggggcttccgcagctgcacaaggcttatcatcatctcaatcaaca
acagtggttgatggcggtgcagtaattggtgcggtaacgggtaataacggtaagtatatt
cttggtcaagcgttaggtggcggtttgagagaaactgcagactggttccgccagcgttat
ggccaaatgtttgatgcggtatatgttccaccgggtaaagaagtggctgtacacatcgaa
aaacaaattgatattgattatgaccgcatgtctagaaaagtgaaatacggacaagcctca
agacaatctaacttggattaa

DBGET integrated database retrieval system