KEGG   Haemophilus parainfluenzae: PARA_11870Help
Entry
PARA_11870        CDS       T01605                                 

Definition
(GenBank) unnamed protein product
Organism
hpr  Haemophilus parainfluenzae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3438 TraK
Motif
Other DBs
NCBI-ProteinID: CBW15292
UniProt: E1W4K0
Position
complement(1185813..1186682)
Genome map
AA seq 289 aa AA seqDB search
MKKLTLLLSAAFIFSPMTASADVLMKWARKPLPIDLQIEKERILFVDKNVKVGYPPELDS
KLRIQSTGGAVYLKATADFPKTRLQLMDVATGEIILLDVQAKHSVANASEPIRFVYENKV
EKQTTAYGQDANAYNEPMPNARPALPAPAALTRYAAQMFYAPLRTVEPLEGVRQVSHRLP
TPLKTLLPALPVRATPLLSWQLDGYVVTAVRLQNQGQSRIDLDPRELQGRFYAATFQHNW
LGGHGTPEDTTTLYLVTEGSPNHSVIPQSNSYKPKKLKKVTTTVTTQTK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactcactttgttactgagcgcggcttttatcttttcaccaatgacggcatct
gccgatgtgttaatgaaatgggcacgcaaaccgttacctattgacttacaaatcgaaaaa
gaacgtattctattcgtagataaaaatgtaaaagtaggttatccacctgaattagatagc
aaacttcgcattcaatcaactggcggtgcggtttatttaaaagcaactgcagatttccca
aaaacacgcttacagcttatggatgttgcaaccggagaaataatcttacttgatgtgcaa
gcgaagcattctgttgccaatgcaagtgagccaattcgttttgtttatgaaaataaagtt
gaaaaacaaacaactgcttatggccaagatgcaaatgcatataacgaaccaatgccaaat
gcgcgtccggcactccccgctccagctgcattaacacgttatgccgcacaaatgttttat
gcgcctttacgtacagttgagcctttggaaggtgtgcgccaagtttcacatcgccttcct
acaccgcttaaaacgctcttacctgcattgcctgtgcgagctactccattactcagctgg
caacttgatgggtatgttgtcactgcggttcgcttgcaaaaccaggggcaatctcgcatt
gatttagatcctcgagaattgcaagggcgattttatgcagcaacatttcagcataattgg
cttggggggcatggtacacctgaagataccacaacgttatatcttgtgacagaaggttca
cctaatcattctgttatccctcagtcaaattcatataaaccgaaaaaattgaaaaaagtc
accacaacagtgacaactcaaacgaaataa

DBGET integrated database retrieval system