KEGG   Haemophilus parainfluenzae: PARA_11890
Entry
PARA_11890        CDS       T01605                                 

Definition
(GenBank) conserved putative membrane protein
Organism
hpr  Haemophilus parainfluenzae
SSDB
Motif
Pfam: DUF3487 Phage_holin_3_6 PrgI MgtE
Other DBs
NCBI-ProteinID: CBW15294
UniProt: E1W4K2
Position
complement(1187338..1187709)
AA seq 123 aa
MSSDKEQTIPFLPTRLNRESSVYGGLSVSEFMLAAAMGFILGAVLGLLCCFALGFDFWLL
IPSLAMLFCILSVVIGKVIIARLKRGKPEAYLNRMIEVKLDGILGGNRFISRQGTWSIRR
VKR
NT seq 372 nt   +upstreamnt  +downstreamnt
atgtcaagtgataaagaacaaacgatcccctttcttcctactcgattaaatcgtgaatcg
agtgtgtatggcgggttatctgtaagtgaatttatgttggctgcagcaatgggatttatc
ttaggtgcagtgcttggcctcctttgttgttttgccttaggctttgatttttggttgtta
attccgtctcttgccatgttgttttgcattctttctgtggtgattggcaaagtgattatt
gcgcgccttaaacgaggtaagccggaagcctacttgaatcgaatgattgaggttaaatta
gatggaatattaggggggaatcgctttatctcccgtcaaggcacttggtctattcgccga
gttaaaagataa

DBGET integrated database retrieval system