KEGG   Haemophilus parainfluenzae: PARA_11920
Entry
PARA_11920        CDS       T01605                                 

Definition
(GenBank) conserved putative exported protein
Organism
hpr  Haemophilus parainfluenzae
SSDB
Motif
Pfam: Plasmid_RAQPRD SMBP MctB
Other DBs
NCBI-ProteinID: CBW15297
UniProt: E1W4K5
Position
complement(1188399..1188749)
AA seq 116 aa
MESVSSKEFSVTKNIFSLSLAIGVLFGAISAQATEQEHLAQAIKQLDAAKLSLQRAAASA
KVSAKSREYFDYASAHQDIATVQAGIKQYINPSRAIPRNPKAIRNLKEDYLNLRSQ
NT seq 351 nt   +upstreamnt  +downstreamnt
ttggaatctgtttcaagtaaggagttctccgtgactaaaaatattttcagtttatctcta
gcaataggggtattgtttggcgctataagtgctcaagcaacagagcaagagcatttagcg
caagcaattaaacagttggatgcagcaaaactctcattacagcgagcagctgcaagtgca
aaggtttctgcgaaaagtcgtgaatattttgattacgcttcagcacatcaagatattgct
acggtacaggcagggattaagcaatatattaacccttcccgggcaatccctagaaatcct
aaagctattcgtaacttaaaagaagattatctcaatcttcggagtcaatag

DBGET integrated database retrieval system