KEGG   Haemophilus parainfluenzae: PARA_11930
Entry
PARA_11930        CDS       T01605                                 

Definition
(GenBank) conserved putative membrane protein
Organism
hpr  Haemophilus parainfluenzae
SSDB
Motif
Pfam: DUF4400
Other DBs
NCBI-ProteinID: CBW15298
UniProt: E1W4K6
Position
complement(1188880..1189566)
AA seq 228 aa
MAEQQVKKKKKGLFYYINAVLAALLGSLILSIILEWLGIAFLWPEEGHLHSQKMMLTELG
WLSDSLTRGLFYHSPKELAEGLILSLHEWLFVKTGVKDWLANPREHSGVGLWVYHYGRAY
IESVIYVFITFVIRLVVIVFTSPLFLLAAFAGFTEGLMMRDRRKFGAGRESSFLYHHARR
LIGPIMLSAWVLYLSIPISIYPNIILVPAAFLFGLSICVTAASFKKYL
NT seq 687 nt   +upstreamnt  +downstreamnt
atggcagaacaacaagtcaaaaaaaagaaaaagggtcttttttactacattaatgcggta
ttagccgccttattgggttccctgattttgagcattattcttgaatggttaggtattgca
tttttatggcctgaagaaggtcatttacacagtcaaaaaatgatgctaactgagcttgga
tggctttctgatagtctaacgagaggtcttttctatcattctccaaaagagctggctgaa
ggtcttattttgtcattacatgaatggctttttgtgaaaacaggtgtaaaagattggtta
gccaaccctcgtgagcatagtggcgtaggtttgtgggtgtatcattatgggcgagcatat
attgagtcagtgatttatgtttttatcacctttgttattcgacttgtagtgattgttttt
acttccccactctttttgttagccgcatttgcgggctttactgaagggttaatgatgcgt
gaccgtcgtaaatttggtgcaggcagagagtctagttttctttatcatcatgcacgtcga
ttaattggcccgattatgttgtcggcatgggtattgtatctttctatcccaatttctatt
tacccgaatataattttggtgccagctgcatttctatttggcctatccatctgtgtaacg
gcagcaagctttaaaaaatacctttaa

DBGET integrated database retrieval system