KEGG   Haemophilus parainfluenzae: PARA_11950
Entry
PARA_11950        CDS       T01605                                 

Definition
(GenBank) putative uncharacterized protein
Organism
hpr  Haemophilus parainfluenzae
SSDB
Motif
Pfam: TraG-D_C TrwB_AAD_bind DUF87 AAA_22 TPR_2 FtsK_SpoIIIE
Other DBs
NCBI-ProteinID: CBW15300
UniProt: E1W4K8
Position
complement(1189885..1192134)
AA seq 749 aa
MSQKHVLEGLLRPPVEFFPAAVHGTCAFVCCGAPWSLALNPLIGYGLGAAFAGMGVMRFR
QGMEIVRYHRNLRRLPHYALTSRQIPVSKKALFLGRGFEWEPKHTQRLYDCFSANGQIYW
KNGKWFKAARDYEKVHDNWLSRLTSMDSPLNPVRPLPPVGGIPVMHGVEPNERDIMLPLG
DRGGHTLVFGTTGVGKTRFAEVLVTQDIHRGKTPEEREVVVFFDPKGDPDMLKRMYAEAK
RAGRENEFYVFHLGHPEISARYNPVGRFGRISEVAGRISGQLSGAGNSAAFKEFAWRFVN
IVSRALVEMGKRPDYVQISRFVQNIDALFLDYAKLHFDAIDKKIWPTLASVAANLDVKNL
PFSMKDRPLIAVINQYILENKIFDPVLEGLSSAVRYDKTYFDKIVASLLPLLEKLTTGKT
AELLSPDYTDIHDERPIFDWESIIRKRGIVYVGLDALSDATVAAAVGNSMFADLVSMAGH
IYKFGVDEGLPDVFKTKSKPPKINLHCDEFNELMGDEFIPLINKGRGAGMQVTAYTQTLS
DIEARIGSKAKTGQTTGNFNTLLMFRVKEPATAEFLTRQLNDVTIYQSMVTSSTTDNSNP
DDGKAFTSNTGERISEKMVPMLSPAHITNLPKGQAFALLEGSTLYKLRMPLPAVDKDDVM
PESLQELTAYMRKNYHISPNWWQSAFSDYAPSQDIATAFQSMSLNRAPSHAGEEMLFGDV
DTPVAEDMEDEDIDQNDDTDEDDFDDTDD
NT seq 2250 nt   +upstreamnt  +downstreamnt
atgagtcaaaaacacgttttagaaggcttgcttagaccgccagttgagtttttcccagct
gccgtccatggtacttgtgcttttgtttgttgcggtgcgccttggtcgctcgcattaaat
cctcttattggatatggattaggcgcagctttcgcaggtatgggagttatgcgttttcgt
caaggcatggaaattgtacgctatcaccgcaatttacgcagactcccacactatgccttg
accagtcgtcaaattcctgtaagtaaaaaagccttgttcttagggcgaggctttgaatgg
gagcctaagcatacgcaacgtctttatgactgcttctctgcaaatgggcaaatttattgg
aaaaatggaaagtggtttaaagccgctcgtgattatgaaaaagtgcatgataattggtta
tctcgactcacttcaatggactctccattaaatccagtaagaccgctaccgccagttggc
ggtattccagtaatgcatggtgtagagccgaatgaacgcgatattatgcttccattaggc
gaccgtggcggtcataccttagtatttggtacgactggtgtaggaaaaacgcgttttgct
gaagtgcttgtgacacaagatatacatcgaggtaaaacacctgaagagcgtgaagtggtt
gtctttttcgatccgaaaggcgacccagatatgttaaaacgaatgtatgccgaagcgaaa
cgtgcggggcgtgaaaatgaattttatgtatttcatctaggtcatcctgaaatatctgct
cgttataacccggttggtcgatttggtcgaatttcagaggtggcaggacgtatttccggg
caattaagtggtgcgggaaatagcgcagcatttaaagagtttgcgtggcgttttgtgaat
attgtctcccgtgcattggttgaaatgggaaaacgcccggattatgtgcaaatctctcgt
tttgtgcaaaatattgatgcgcttttcttagattatgccaaacttcatttcgatgctata
gataagaaaatatggccaactttggcttcggttgcggctaacttagatgtaaaaaactta
ccgttctcgatgaaagatagaccactgattgctgttattaaccaatatattttagagaat
aagatttttgaccctgtacttgaagggttatcaagtgcggtacgttacgataaaacctat
tttgataaaattgtggcatcgcttttaccgttacttgaaaaactcacaacaggtaaaact
gctgagcttctctcgcctgattacactgatattcatgatgagcgccctatctttgattgg
gaatctattattcgcaaaagaggaattgtctatgttggattggatgcattatccgatgcg
accgtggctgcagctgtgggtaatagtatgtttgctgatttagtatcaatggctggtcat
atttataaatttggtgtagatgagggtttaccggatgtatttaaaactaaaagtaaacca
cctaaaatcaaccttcattgcgatgaatttaatgaattaatgggtgatgaatttattccc
cttatcaataaaggtcgtggtgcgggaatgcaggtaacagcctatactcaaacactttca
gatattgaagctcgtattggaagtaaagcgaaaacgggacaaacaacaggtaacttcaat
acacttttaatgttccgggtaaaagagccggccactgcagagtttttaacgcgtcagctc
aacgatgtcacaatttatcaaagcatggtgacatcaagtacgacagataacagcaatccg
gatgatggcaaggcgtttacgtctaatactggtgaacgtatttctgaaaaaatggtgcca
atgttatcgccagcacatattacaaatctaccaaaaggtcaggcatttgcccttcttgag
ggaagtacgctttataaattaagaatgcctttacctgcggttgataaagatgatgtgatg
ccggagtcactccaagaattaacagcttacatgcgtaaaaactaccatatttctccaaat
tggtggcaatctgcattttctgattatgcgccaagtcaagatatagcaaccgcttttcag
tcaatgtcattaaatcgagcaccttcacacgcaggagaagaaatgcttttcggggatgtt
gatactccagttgctgaagatatggaagatgaagatattgatcagaatgatgatacagat
gaggatgattttgatgacacagatgattaa

DBGET integrated database retrieval system