KEGG   Haemophilus parainfluenzae: PARA_11970Help
Entry
PARA_11970        CDS       T01605                                 

Definition
(GenBank) unnamed protein product
Organism
hpr  Haemophilus parainfluenzae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SLT
Motif
Other DBs
NCBI-ProteinID: CBW15302
UniProt: E1W4L0
Position
complement(1192653..1193411)
Genome map
AA seq 252 aa AA seqDB search
MATNRLLKIVFSLIGLGVATHSVAFNGFGTDIDGYIKDASNRYQVDEAMLRGLVKIEDGW
YGNVSPTGATGVGQFTRGTWNWLATTDEGRALGMTLITRYNRDTPFDPRKNNQINTLATA
LYARWHINQFFERGIKPSHENLYLAHNIGIDGLHRALQGRATREDILNMKRNGMKKGMSV
QGFLVYQSERFNVSKQIANFQRPSVSPRYQIENKPLPANLHWVSPTETAMRWVEPASNQT
NQQAIRWQNPTN
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaaatcgtctattaaaaatcgtatttagcttaatcggtcttggagttgcgact
cactccgttgcatttaatggctttggaactgatattgatggctatattaaagatgcatct
aatcgctaccaagtcgatgaagcgatgctacgtgggttagtaaaaattgaagatgggtgg
tatggaaatgtttccccaaccggggcaaccggtgtggggcaatttacccggggcacttgg
aattggcttgccacaacagatgagggacgtgctttagggatgacgctgatcacccgttat
aatcgagatacgccttttgacccgcgcaaaaataatcagataaacactttagcaaccgca
ctttatgcgagatggcatattaatcagttttttgagcgaggcataaaaccatcccatgaa
aatttatatcttgctcataatatcggtatagatggtttacatcgagcgctacaaggtaga
gcaacacgtgaagatattctaaacatgaagcgcaacgggatgaaaaaaggaatgtcggta
caaggctttcttgtttatcaaagtgagcgttttaatgtcagtaaacaaatagctaacttc
cagcgcccttcagtatcaccacgttatcaaattgagaataaaccattaccagccaattta
cattgggtttctccaacagaaaccgctatgcgttgggttgagccagcgtcaaatcaaaca
aatcaacaagctattcgttggcaaaatccaaccaattaa

DBGET integrated database retrieval system