KEGG   Haemophilus parainfluenzae: PARA_11990
Entry
PARA_11990        CDS       T01605                                 
Symbol
pilL
Name
(GenBank) putative lipoprotein precursor
Organism
hpr  Haemophilus parainfluenzae
SSDB
Motif
Pfam: LPAM_1 EstA_Ig_like DUF6491
Other DBs
NCBI-ProteinID: CBW15304
Position
complement(1194135..1194761)
AA seq 208 aa
MKKILLTTFALVVLSGCAHRQTADEQQALENPSIQQGQHQVLQPEDRIVRPDIYTDYQPE
RTEVLREGRYTLINFSPEEGQKYLLDQSVSVNMLGKKKRALTATVEQGLRTTLKDTGLSL
CHGFGQNEPTLSTLYSRPLPKVHYQFGPMALRDALQMLAGPAYEITINDVSRTVCFKLRP
AVPERATGEKPKVETTTTTTTTTEIIEE
NT seq 627 nt   +upstreamnt  +downstreamnt
atgaaaaaaattctattaaccacgtttgcattggttgtgctttcaggttgtgcgcacaga
caaacagccgatgaacaacaagcattagaaaatccaagtattcaacaaggtcaacatcaa
gtcttacaaccggaagatcgcatagtccgtccggatatttacacagactatcaacctgaa
cgtacagaagtgttacgtgaaggtcgttatactttaattaatttttctccggaagaaggt
caaaaatatcttcttgaccaaagtgtctccgtcaatatgttaggcaaaaagaaacgtgcc
ttgactgcaactgttgaacaaggattacgtactacattaaaagatacgggcctttcactt
tgccatggctttggtcagaatgaaccaacactttctacactttattcccgtccattacca
aaagtacattaccaatttggcccgatggctttacgtgatgcccttcaaatgttagcgggg
ccagcttatgaaatcactatcaatgatgtttctcgtaccgtttgttttaaattacgccca
gctgtaccggaacgtgctacaggggaaaagccgaaagtagaaactacgacaacgacaaca
accacaacggaaattatcgaggaataa

DBGET integrated database retrieval system