KEGG   Haemophilus parainfluenzae: PARA_12000Help
Entry
PARA_12000        CDS       T01605                                 

Definition
(GenBank) unnamed protein product
Organism
hpr  Haemophilus parainfluenzae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraX DUF441
Motif
Other DBs
NCBI-ProteinID: CBW15305
UniProt: E1W4L3
Position
complement(1194860..1195624)
Genome map
AA seq 254 aa AA seqDB search
MINKTLFNSITMPYLTSSQTECLKWLALITMIIDHIGVAFSNAYPALSWCRVIGRFSYVA
FGFIIALNLSRDKVNFKSYFTWMIATAFLSEISFTLFEPNYDRLNVLFQFLSVIGVIWVY
KNRQDLNSWVMFLGLGFFIILSALSDYGLPGLLYCIGCYLFLQTKDTQYHLITMLTCVLL
ALFVNHSFIDNFGETIVETVSVVAVVIGTMIFILHPKGLRQCNLSISRMPKAFFYLFYPV
HLTIIVGIKYIFIS
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgataaataaaactctttttaatagtataacgatgccttatttaacctcttctcaaact
gaatgcctaaaatggttagcactcattacaatgattattgatcatattggcgtggctttt
tcaaatgcttacccggccctatcttggtgtcgggtgatagggcgattttcctacgtggcg
tttggatttatcatcgcgcttaatttatctcgagataaagtgaactttaaaagttatttc
acttggatgatagcaaccgcatttttatctgaaatcagttttacgcttttcgagcctaat
tatgaccgtttaaatgtcctatttcagttcttatctgtaatcggggtaatatgggtatat
aaaaaccgtcaagacttaaatagctgggtcatgtttttgggattgggcttttttattatt
ctttccgcactctctgattatggtttacctgggcttttatattgcattggttgttatctc
tttttgcaaacaaaagatactcaatatcatcttattacgatgctaacctgtgtattgctc
gcacttttcgtcaatcacagttttattgataatttcggggaaactattgttgaaacagtt
agtgtcgtcgctgttgtaattggcacaatgatatttattcttcaccctaaaggccttcgt
caatgtaatctctcaatctctcgtatgcctaaggctttcttttaccttttttacccagtt
catttaacaattattgttggaataaaatatatttttatcagctaa

DBGET integrated database retrieval system