KEGG   Haemophilus parainfluenzae: PARA_14090Help
Entry
PARA_14090        CDS       T01605                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methylerythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hpr  Haemophilus parainfluenzae
Pathway
hpr00900  Terpenoid backbone biosynthesis
hpr01100  Metabolic pathways
hpr01110  Biosynthesis of secondary metabolites
hpr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hpr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PARA_14090
Enzymes [BR:hpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     PARA_14090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: CBW15510
UniProt: E1W566
Position
complement(1413003..1413926)
Genome map
AA seq 307 aa AA seqDB search
MKTHHFSTALSTSLGKPNRFPSPAKLNLFLYINGKLPNGYHELQTLFQFLDFGDWLTIDI
RQDKQIHITPEIPGLPLEQNLIYRAATLLQEKTGCTLGATIHLDKILPMGGGIGGGSSNA
ATTLLALNYLWQTHLSIDELAELGLKLGADVPIFVHGQAAFAEGVGEKIQYCEPLEKYYV
VLKPETAISTAVVFSDPDLPRNTEKRSLAELLNHPFANDCEKVVRTQYPEVEKALLWLLQ
YAPARLTGTGACVFAEFDDEKSAQAVFQQKPKEFFGFVAKGLNVSPLHAMLKQLSTNQSI
YTQPEVI
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacacatcacttttcaaccgcactttcaacttctcttggaaagcctaaccgcttt
ccaagccccgcaaaactcaatttatttctctatataaacggtaaactgccaaacggctac
cacgaattacaaacgcttttccaatttcttgatttcggcgattggctcaccattgatatt
cgccaagataaacaaatccacatcacaccagaaattcctggcttacctctagaacaaaat
ttaatctatcgtgcagcgacactactacaggaaaaaacaggctgtacgctcggtgccaca
attcatttagataaaattctgccaatgggcggtggtattggtggcggttcatccaatgcg
gcaactaccctccttgctttaaactatttatggcaaacccatttatctattgatgaactt
gctgagctcggactaaaacttggtgcagatgtccccatctttgttcatggtcaagccgct
tttgcagaaggcgtaggtgaaaaaatccaatactgtgaaccactagaaaaatattatgtg
gtactaaaacctgaaactgcgatttctactgcggtggtttttagcgatcccgatttgcct
cgcaatacagaaaaaagatctcttgctgaacttctgaatcacccgtttgcaaacgattgc
gaaaaagtcgtacgaactcaatatccagaagttgaaaaagccctattatggttgctacaa
tatgcaccagccagattaaccggaaccggagcttgtgtttttgctgaatttgatgatgaa
aaatcagcacaagctgttttccaacaaaaaccgaaggaatttttcggctttgttgctaaa
ggattaaacgtttcaccattacatgcgatgttgaaacaactctcgaccaaccaatctatc
tatactcaacctgaggttatataa

DBGET integrated database retrieval system