KEGG   Haemophilus parainfluenzae: PARA_18710Help
Entry
PARA_18710        CDS       T01605                                 

Definition
(GenBank) unnamed protein product
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
hpr  Haemophilus parainfluenzae
Pathway
hpr00620  Pyruvate metabolism
hpr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PARA_18710
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hpr02000]
    PARA_18710
Enzymes [BR:hpr01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     PARA_18710
Transporters [BR:hpr02000]
 Other transporters
  Primary active transporters [TC:3]
   PARA_18710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 Peptidase_M23 DUF5525
Motif
Other DBs
NCBI-ProteinID: CBW15971
UniProt: E1W6H7
Position
1930700..1932490
Genome map
AA seq 596 aa AA seqDB search
MTKKIKMTELVLRDAHQSLFATRLRLDDMLPIAHELDDIGYWSLEAWGGATFDSCIRFLG
EDPWVRLRELKKACPKTPLQMLLRGQNLLGYRHYADDVVERFVERCVANGMDVFRVFDAL
NDPRNMKAALQAVRKFGGHAQGTLSYTTSPVHTMQTWLDTTEQLLEIGIDSLVIKDMSGI
LNPMAAAELVREIKKRFDVELHLHCHSTTGMAEMALLKAVEAGVDGIDTAISSMSGTYGH
PATESMVATLQGTEYDTGLDIPRLEKISAYFRNVRKKYAKFEGQLRGVDSRILVAQVPGG
MLTNLENQLKQQNASDKLDLVLEEIPRVRKDLGYIPLVTPTSQIVGTQSVINVLTGERYK
TIAKETAGILKGEYGKTPAPVDSALQARVLEGAAPVTDRPADHIAPEMAKIEAEVAEQAK
AKGVKLADNAVDDALIVALFPQIAWKFLENRNNPAAFEPAPTGNESAVENKPVSKATPSV
SGSAIYTVELEGKAFVVKVSEGGDISHVATTAPQAAPQATPAPATGGTPVTAPMAGNIWK
VVATEGQTVAAGDVLFILEAMKMETEVKAAQAGTVRGICVKAGDAVAVGDTVMTLA
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaaaattaaaatgacagaactggtgcttcgtgatgcccaccaatcacttttc
gcaactcgcttgcgtcttgatgatatgttgccaattgctcatgaattagatgatatcggc
tattggtcattggaagcttggggcggtgcaacatttgatagctgtattcgctttttaggt
gaagatccttgggttcgtttgcgtgaattgaaaaaagcctgtccaaaaaccccattacaa
atgttattacgtggtcaaaacctattaggctatcgccactatgctgatgatgtggtagaa
cgtttcgtagaacgttgtgtagcgaatggtatggatgttttccgcgtattcgatgcgctc
aatgacccgcgcaacatgaaagccgcgttgcaagcagtacgtaaatttggtggtcatgct
caagggactttaagttataccaccagccctgtacatactatgcaaacctggcttgatacc
actgaacaattgcttgaaataggtatcgacagcttggtcatcaaagacatgtcaggtatt
ttaaatccaatggcggcggcagagttagtacgcgaaatcaaaaaacgtttcgacgtagaa
ttgcatttacactgccactccaccactggtatggcagaaatggcgttattaaaagcggtt
gaagcaggtgtagatggtattgatacagcaatttcttctatgtcaggtacttatggtcac
cctgcaacagaatccatggtcgctaccttacaaggcactgaatatgacaccggtttagat
attcctcgtttggaaaaaatctcggcctatttccgcaatgtacgtaaaaaatacgctaaa
tttgaaggccaattacgtggtgtcgatagccgtattttagtagcacaagtgccaggcggc
atgcttacaaacttagaaaaccaattaaaacaacaaaatgcgtccgataaattagattta
gtgttagaagaaatcccacgcgtacgcaaagacttaggctacattccactcgttacacca
acctctcaaattgttggtacacagtcggttattaacgtacttactggcgaacgctacaaa
actatcgccaaagaaactgctggtattttaaaaggtgaatatggtaaaacgcctgcacca
gtagatagtgcgttgcaagctcgagtattagaaggcgctgcaccagtaacagaccgtcca
gccgatcacattgcgcctgaaatggcgaaaattgaagctgaagttgcagaacaagctaaa
gcgaaaggcgtgaaattagcggacaatgctgtggatgatgccttaatcgtagcactcttc
cctcaaattgcgtggaaattcttagaaaaccgcaacaatcctgcagcctttgaacctgct
ccaactggtaatgaaagtgcggtggaaaataaaccagtttctaaagctacaccatctgtt
tctggctccgctatttataccgtggaattagaaggtaaagcttttgtggtgaaagtaagc
gaaggcggtgacatctctcatgtcgcgactacagctcctcaagctgcgccacaagcgact
ccagctccagcaacgggtggtacaccagtaacagcgccgatggcgggtaatatttggaaa
gttgttgcaacagaaggtcaaactgtagcagctggcgatgtattattcattctcgaagcc
atgaaaatggaaaccgaagtgaaagctgcacaagctggtaccgtacgcggcatttgcgtc
aaagctggtgatgctgtcgccgtaggtgataccgtgatgaccttagcataa

DBGET integrated database retrieval system