KEGG   Haemophilus parainfluenzae: PARA_19790Help
Entry
PARA_19790        CDS       T01605                                 

Definition
(GenBank) DNA polymerase III, chi subunit
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
hpr  Haemophilus parainfluenzae
Pathway
hpr00230  Purine metabolism
hpr00240  Pyrimidine metabolism
hpr01100  Metabolic pathways
hpr03030  DNA replication
hpr03430  Mismatch repair
hpr03440  Homologous recombination
Module
hpr_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:hpr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PARA_19790
   00240 Pyrimidine metabolism
    PARA_19790
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PARA_19790
   03430 Mismatch repair
    PARA_19790
   03440 Homologous recombination
    PARA_19790
Enzymes [BR:hpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     PARA_19790
DNA replication proteins [BR:hpr03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     PARA_19790
DNA repair and recombination proteins [BR:hpr03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     PARA_19790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi IDEAL SCNM1_acidic
Motif
Other DBs
NCBI-ProteinID: CBW16079
UniProt: E1W6T5
Position
complement(2053780..2054211)
Genome map
AA seq 143 aa AA seqDB search
MAKNAQFYLLNPEKKITVEQLACDLAAQAWRLGKRVLIACETEEQAFLIDEALWQRDPNE
FVPHNLSGEATQYAPPIEISWKGKRNAQRRDLLINLQMEVPDFSHSFTQLIDFVPVEETQ
KAQARERYKILRSQGWMLSTENT
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaacgcacaattttatctcttaaatccagaaaagaagataacagttgagcaa
cttgcctgtgatcttgccgctcaagcgtggcgtttaggtaagcgagttttaatcgcgtgt
gaaacagaagagcaagcatttttaattgatgaagcattatggcaacgggatccaaatgag
tttgttccccataatctttcgggcgaagcaacacaatatgcaccgccaattgagattagt
tggaaaggcaaacgtaatgcccagcgtcgtgatttgctgatcaatttacaaatggaagtg
ccggattttagtcacagctttacacaattaattgattttgtaccggtagaagaaacgcaa
aaagctcaagcgcgtgaacgttataaaatccttcgctcgcaaggttggatgctttctact
gaaaacacttaa

DBGET integrated database retrieval system