KEGG   Helicobacter pylori Shi470: HPSH_01435Help
Entry
HPSH_01435        CDS       T00742                                 

Definition
(GenBank) hypothetical protein
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hps  Helicobacter pylori Shi470
Pathway
hps00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hps01100  Metabolic pathways
hps01110  Biosynthesis of secondary metabolites
hps01130  Biosynthesis of antibiotics
hps01230  Biosynthesis of amino acids
Module
hps_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hps00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPSH_01435
Enzymes [BR:hps01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HPSH_01435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: ACD47739
Position
269366..269923
Genome map
AA seq 185 aa AA seqDB search
MQEIGILENLQKSLALKEGMLSYEMLGKSLSYNPYLPRVIPQIKDCVFVTPDEVLGKLLE
ENARTDCVIVNFKGLYEIGAPSVFDLEVLGLLRRHASSLIVHQDLFISHYQLLESLVQGS
DGVILDEELLKEDLKGMAEFAWRLGLSVFVETHKQDYTHLKDLGVLGVLEKVPHSQNQKK
IVFLD
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaatagggattttagaaaatttacaaaaaagcttagccttaaaagagggcatg
ctttcttatgaaatgctgggtaaaagcctgtcgtataacccttacttgcctagagtcatt
cctcaaattaaagattgtgtttttgtaacccctgatgaggttttaggaaagcttttggaa
gaaaacgcccgcaccgattgcgtcattgtcaatttcaaaggattatacgaaataggcgcg
ccaagcgtgtttgatttagaagttttagggttgttgcgccgccatgcgagctctttgatt
gtccatcaagatcttttcatcagccattaccaacttttagaatcgcttgttcaaggctct
gatggggtcattttagacgaagagcttttgaaagaagatttaaagggcatggcagaattt
gcttggcgtttgggcttaagcgtgtttgtagaaacccacaaacaagactacacccattta
aaagatttaggggttttaggcgtgctagaaaaagtcccccattctcaaaatcaaaaaaaa
atagtttttttagattga

DBGET integrated database retrieval system