KEGG   Helicobacter pylori Shi470: HPSH_01890Help
Entry
HPSH_01890        CDS       T00742                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase catalytic subunit
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
hps  Helicobacter pylori Shi470
Pathway
hps00240  Pyrimidine metabolism
hps00250  Alanine, aspartate and glutamate metabolism
hps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hps00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    HPSH_01890 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HPSH_01890 (pyrB)
Enzymes [BR:hps01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     HPSH_01890 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ACD47828
UniProt: B2USJ6
Position
362121..363044
Genome map
AA seq 307 aa AA seqDB search
MPKKCRHLLQTSDLSLDEIKLLLKKASVYANDFNAVSLETKEKMQNKIIVALFFENSTRT
VSSFEIASLRLGAKIVKLNMQTSSASKGETLTDTFKNIYAMQPDAIITRHAFSSAPFKLA
EFSQCPLINAGSGVSAHPTQALLDLLTLYQHFGSLENLKGKKIAFIGDVKNSRVANSNIK
LLQRLGLEIMLCAPSSMLPSVSLKTTHNIEEAIEFADILMSLRTQTERHNAPIFASLKDY
GNAYCITQKRLEAHAKNKEIIILHPGPVHRDIDIESAVLEDKRSKVLEQVKNGVAMRMAV
LEFLLLD
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaaaatgccgacacttgctccaaaccagcgatttaagcctagatgaaatcaag
cttttattaaaaaaagcgagcgtttatgcgaacgattttaacgccgtatctttagaaaca
aaagaaaaaatgcaaaataaaatcatcgtggctttattttttgaaaattccaccagaacg
gtgtctagttttgaaatcgcaagcttgagattgggggcaaaaatcgtgaaattaaacatg
caaacaagctccgcttcaaagggtgaaaccctaacagacacttttaaaaatatctatgcc
atgcagcctgacgctatcatcacacggcatgctttttcaagcgcgccttttaaattagcc
gaattttcacaatgccccttgattaacgcaggaagcggcgtaagcgctcatcctacccaa
gcgttattagatttgctcaccctttatcagcattttggcagtttagaaaatttaaaaggg
aagaaaatcgctttcataggcgatgtgaaaaattccagagtggctaatagcaacattaaa
ttgctccaaaggctagggcttgagatcatgctgtgcgctccaagctccatgctccctagc
gtttctttaaaaacgacgcataacattgaagaagcgatagagtttgcagacattttaatg
agtttgaggactcaaaccgaacggcacaacgcgcccatttttgcgagcttgaaagattat
ggaaacgcttattgcatcacccaaaaacgcctagaggctcacgctaaaaataaagagatc
attattttacacccaggcccggtgcatagggatattgatatagaaagcgcggtgttagaa
gataagcgatctaaagttttagagcaggtcaaaaacggcgtggcgatgcgcatggcggtg
ttggagtttttgctattagattga

DBGET integrated database retrieval system