KEGG   Helicobacter pylori Shi470: HPSH_03405Help
Entry
HPSH_03405        CDS       T00742                                 

Definition
(GenBank) acetyl coenzyme A acetyltransferase (thiolase) (fadA)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hps  Helicobacter pylori Shi470
Pathway
hps00071  Fatty acid degradation
hps00072  Synthesis and degradation of ketone bodies
hps00280  Valine, leucine and isoleucine degradation
hps00310  Lysine degradation
hps00362  Benzoate degradation
hps00380  Tryptophan metabolism
hps00620  Pyruvate metabolism
hps00630  Glyoxylate and dicarboxylate metabolism
hps00640  Propanoate metabolism
hps00650  Butanoate metabolism
hps00900  Terpenoid backbone biosynthesis
hps01100  Metabolic pathways
hps01110  Biosynthesis of secondary metabolites
hps01120  Microbial metabolism in diverse environments
hps01130  Biosynthesis of antibiotics
hps01200  Carbon metabolism
hps01212  Fatty acid metabolism
hps02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPSH_03405
   00630 Glyoxylate and dicarboxylate metabolism
    HPSH_03405
   00640 Propanoate metabolism
    HPSH_03405
   00650 Butanoate metabolism
    HPSH_03405
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HPSH_03405
   00072 Synthesis and degradation of ketone bodies
    HPSH_03405
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HPSH_03405
   00310 Lysine degradation
    HPSH_03405
   00380 Tryptophan metabolism
    HPSH_03405
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPSH_03405
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HPSH_03405
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HPSH_03405
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hps04147]
    HPSH_03405
Enzymes [BR:hps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HPSH_03405
Exosome [BR:hps04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPSH_03405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACD48120
Position
complement(649388..650563)
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAVGSFLGSLKSVGAREMGAVVLKDALKASGLKPSDVDSVILGNVLSAG
LGQNIARQIQLDAGIPNDRNAFSVNMVCGSSMKAIQLAHDSIMLGRDEVVVCGGVENMSA
APYLSFDMRDGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNVAQAYHISREEQDAFAL
QSQLKARAAINAGKFQEEITPIEIANKKGVVVFKEDEYPRETTLESLAKLKPAFKKDGSV
TAGNSSGINDGASIIILCSAQKVQKLGLKTMATIKGFGLGGCSPDIMGICPSIAIKNNLK
NVKMNLNDIDLFELNEAFAAQSIAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSGHGVGCASLCVGGGQGLSVVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcggcaaaacgaagtgctgtgggaagttttttaggctct
ctaaagagcgtgggcgctagagaaatgggcgctgtcgtgcttaaagacgctttgaaggcg
agcggtcttaagcctagcgatgtggattctgtcattttaggcaatgttttatccgccggt
ttgggtcaaaatatcgccagacagatccaactggacgctggcataccgaatgacaggaac
gcttttagcgtcaatatggtttgtggatcgtctatgaaagccattcaattagcgcatgac
agcatcatgcttgggcgcgatgaggtggtggtgtgcggtggcgtggaaaacatgagtgca
gccccctatttgtcgtttgacatgcgagatgggaaaagaatggggaatgcgaacatgata
gactccatgattcatgacggattgtgggatgcgttcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccacatcagccgagaagagcaagatgctttcgcgctc
caatcgcaactcaaagcaagagccgccattaatgcagggaaattccaagaagaaatcacg
cctattgaaatagcgaataaaaaaggcgtggttgtttttaaagaagacgaataccctaga
gaaacgacgctagaatcccttgcaaagctcaaacccgctttcaaaaaagacggatcggta
acggcaggaaattcatcagggatcaatgatggcgcgagtattatcattttatgcagcgct
caaaaagtgcaaaaattggggttaaaaacaatggcaactatcaaggggtttggtttgggt
ggttgcagtccggatataatggggatatgccctagtatcgctattaaaaacaatcttaaa
aatgtcaaaatgaatctcaacgacatcgatctttttgaactcaatgaagccttcgccgcg
caaagcatagccgtgttaaaagagcttgaattaaaccccaatatcgtgaatgtgaatgga
ggcgcgatagccattggccaccctattggtgcaagcggcgctaggattttggtaacttta
ttgcatgaaatgaaaagaagcggtcatggcgtgggctgcgcgtcattgtgtgtgggcggc
ggacaagggctatcagtggtagtggaacaaaaataa

DBGET integrated database retrieval system