KEGG   Helicobacter pylori Shi470: HPSH_03630Help
Entry
HPSH_03630        CDS       T00742                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase (galU)
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hps  Helicobacter pylori Shi470
Pathway
hps00040  Pentose and glucuronate interconversions
hps00052  Galactose metabolism
hps00500  Starch and sucrose metabolism
hps00520  Amino sugar and nucleotide sugar metabolism
hps01100  Metabolic pathways
hps01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hps00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HPSH_03630
   00052 Galactose metabolism
    HPSH_03630
   00500 Starch and sucrose metabolism
    HPSH_03630
   00520 Amino sugar and nucleotide sugar metabolism
    HPSH_03630
Enzymes [BR:hps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HPSH_03630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 P53_C Glycos_transf_2
Motif
Other DBs
NCBI-ProteinID: ACD48163
Structure
PDB: 

Position
complement(697700..698521)
Genome map
AA seq 273 aa AA seqDB search
MIKKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLIQYAVEEAMEAGCEVMAIVTGRNKR
SLEDYFDTSYEIEHQIQGTNKENALKSIRNIIEKCCFSYVRQKQMKGLGHAILTGEALIG
NEPFAVILADDLCISHDHPSVLKQMISLYQKYQCSIVAIEEVALEEVSKYGVIRGEWLEE
GVYEIKDMVEKPSQEDAPSNLAVIGRYILTPDIFEILSETKPGKNNEIQITDALLTQAKR
KRIIAYQFKGKRYDCGSVEGYIEASNAYYKKRL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgcctttttcctgccgctggctacggcacgcgctttttgccgatcact
aaaaccattcctaaagaaatgctgcccattgtggataagcctttaatccaatacgctgta
gaagaagcgatggaagcaggctgtgaagtgatggcgatcgttacaggcagaaacaagcgc
agtttagaagattattttgacacgagctatgaaatagagcatcaaatccaaggcactaac
aaagaaaacgccctaaaaagcattcgtaacattatagaaaaatgctgtttttcctatgtg
cgccaaaagcaaatgaaaggattagggcatgcgattttaaccggagaagccctcataggc
aatgagccttttgcggtgattttagccgatgacttatgcataagccatgatcacccaagc
gtgctaaagcaaatgatttcattgtatcaaaaataccaatgctccattgtagccattgaa
gaagtggcactagaagaagtctcaaaatacggcgtgattaggggcgaatggttagaagag
ggggtgtatgagattaaagacatggtggaaaaaccaagccaagaagacgccccaagcaat
ctagccgtgatagggcgctacattctaaccccggatatttttgaaattttaagcgagacg
aaaccgggcaaaaacaatgaaatccaaatcacagacgccttactcactcaagccaaaaga
aaacggatcatcgcttaccaattcaagggcaaacgatacgattgcgggagcgtggaaggc
tatattgaagcgagtaacgcttattataaaaaacgcttgtaa

DBGET integrated database retrieval system