KEGG   Helicobacter pylori Shi470: HPSH_04160
Entry
HPSH_04160        CDS       T00742                                 

Definition
(GenBank) cag pathogenicity island protein (cagD, cag24)
  KO
K12109  cag pathogenicity island protein 24
Organism
hps  Helicobacter pylori Shi470
Pathway
hps05120  Epithelial cell signaling in Helicobacter pylori infection
Module
hps_M00564  Helicobacter pylori pathogenicity signature, cagA pathogenicity island
Brite
KEGG Orthology (KO) [BR:hps00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    HPSH_04160
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hps02044]
    HPSH_04160
Secretion system [BR:hps02044]
 Type IV secretion system
  Cag pathogenicity island (PAI) protein
   HPSH_04160
SSDB
Motif
Pfam: CagD
Other DBs
NCBI-ProteinID: ACD48267
Position
808744..809367
AA seq 207 aa
MINNNSNKKLRDFFLKVLLSLVVFSSYGSANDDNQAKKEALEKEKNTPSGRVYTNLDFDS
FKATIKNLKDKKVTFKEVNPDIIKDEVFDFVIVNRVLKKIKDLKHYDPIIEKIFDEKGKE
MGLNVELQINPEVKDFFTFKSISTTNKQRCFLSLHGETREILCDDKLYNVLLAVFNSYDP
NDLLKHISTIESLKKIFYTITCEAVYL
NT seq 624 nt   +upstreamnt  +downstreamnt
ttgatcaacaataatagtaataaaaaactaagagacttttttttgaaagttctcttaagt
ctcgttgttttcagttcgtatgggtcagcaaatgatgataatcaagcgaaaaaagaagcg
ctagaaaaagaaaaaaacactcctagtgggcgtgtttatacgaatttagattttgatagt
ttcaaggcgactatcaaaaatttgaaagacaagaaagtaactttcaaagaagtcaatccc
gatattatcaaagatgaagtttttgacttcgtgattgtcaatagagtccttaaaaaaata
aaggatttgaagcattacgatccaattattgaaaaaatctttgatgaaaaaggtaaagaa
atgggattgaatgtagaattacagatcaatcctgaagtgaaagacttttttactttcaaa
agcatcagcacgaccaacaaacaacgctgctttctgtcattgcacggagaaacaagagaa
attctatgcgatgataagctatataatgttttgttggccgtattcaattcttatgaccct
aatgatcttttgaaacatattagcactatagagtctctcaaaaaaatcttttatacgatt
acatgtgaagcggtatatctataa

DBGET integrated database retrieval system