KEGG   Helicobacter pylori Shi470: HPSH_04275Help
Entry
HPSH_04275        CDS       T00742                                 

Definition
(GenBank) cag pathogenicity island protein (cagW, cag9)
  KO
K12094  cag pathogenicity island protein 9
Organism
hps  Helicobacter pylori Shi470
Pathway
hps05120  Epithelial cell signaling in Helicobacter pylori infection
Module
hps_M00564  Helicobacter pylori pathogenicity signature, cagA pathogenicity island
Brite
KEGG Orthology (KO) [BR:hps00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    HPSH_04275
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hps02044]
    HPSH_04275
Secretion system [BR:hps02044]
 Type IV secretion system
  Cag pathogenicity island (PAI) protein
   HPSH_04275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACD48290
Position
829423..831030
Genome map
AA seq 535 aa AA seqDB search
MFNIKRIFLITIISFFLIVPNWLKAIDLPIVSNLKIYQTVYCMLIPSYVLTNKSFADILT
GYTSIGASGSGKSSGQGVIEALSAPLATSLAASNLVKYLNTLGPLWGSAWASVATAIQGF
ALTPSSGCNFGWNALINKNIDVSTDSMLDNLSNKIRNFTKGGVEDNVKGNVLLQIIGSIT
AQVSTNITANSLIWLIGKEFTANKLQNNTTAMLAFAALESIVKGADATVLPAYSVVNLPD
IIIGQGSYLDFVSYLIYIVFGIFVFISFMKLRDISNGIQINIGFEYMRFVGGTLFKMAMV
SFIAYAGFGYLYKISYSIYFGLAGAFGLNQTLFWALDLVLNYTVNSILPAVRAVFSNVGN
NAPSLLQGLQVAGISLFAIFMQVTIIMRISTVVVKPLIAGAFSGIVFPIAVCLIVLDWFK
DSMKNILIWFINNLFILVLAIPILLFGVLALLAFNLTITPSVAIQNINQGGLGIDSTIAS
LITLFILKGFIETIIESVNAIVNTIFSSVSMDGSRMDRERDALMVGKVGGSMFKG
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatatcaaaaggatttttttaataacgatcataagtttttttctcattgttcct
aattggttgaaagctattgatttgcccattgtttcaaatctcaaaatttaccaaacagtt
tattgcatgctgataccgagttatgttttaaccaacaaaagttttgcagatattttgaca
ggttatacatctattggtgcgtcagggagtggaaagagttcagggcagggtgtgatcgaa
gcgcttagtgcaccattagctacaagtttagccgctagcaatctagtgaaatatttgaat
actttaggtcctttatggggatcggcgtgggcaagtgttgctacagctatacaaggtttt
gctctaaccccatcaagtggttgcaattttggttggaacgcattgataaataaaaacata
gatgtatccacagatagcatgctagacaatttgagcaacaagattcggaattttaccaaa
ggcggtgttgaggacaatgtgaaaggcaatgttcttttacaaataattggctcaataacc
gctcaagtttctacgaatattacagctaatagtttaatttggctgattggcaaagaattc
actgcaaataaactgcaaaacaacactacagccatgcttgcttttgccgcactagaatct
attgtcaaaggagcggacgctactgttcttcctgcatatagtgtagtcaatctgcctgat
attatcatagggcaagggtcatatcttgattttgtttcttacctaatttatattgttttt
gggatttttgtttttatttcttttatgaaattgagagatatttcaaatggcattcagatt
aacataggttttgaatacatgcgatttgttggggggacattattcaaaatggcgatggta
tcttttatcgcctatgcaggttttggttatctttataaaatctcttattccatttatttt
ggtttagcaggcgcttttgggctgaatcaaactcttttttgggctttagatttagtgctg
aattacactgttaattcaattttacctgcggtaagagctgttttttctaatgttggcaac
aacgctcctagtttgttacaaggcttgcaagttgcaggtatttctttattcgctattttt
atgcaagtaactatcattatgagaataagcactgttgttgtgaaacctttgatagcgggg
gcttttagcggtattgtgttccctattgcggtatgtttgatcgtgctagattggttcaaa
gattctatgaaaaacatattgatatggtttattaataatttgtttatcttggttctagct
attcctattttgctctttggtgttttggcattattggcattcaatttgaccataacgccc
tctgttgctatacaaaacatcaatcaagggggactgggtatcgattcgactattgcgagt
ttgatcactttatttattttaaaaggtttcatagagacgattattgagagtgtcaatgcg
atcgttaataccattttcagttctgtctctatggatggtagcagaatggatagggaacga
gatgccttaatggtaggaaaagttggtggatctatgtttaaaggataa

DBGET integrated database retrieval system