KEGG   Helicobacter pylori Shi470: HPSH_04295
Entry
HPSH_04295        CDS       T00742                                 

Definition
(GenBank) cag pathogenicity island protein (cagZ, cag6)
  KO
K12091  cag pathogenicity island protein 6
Organism
hps  Helicobacter pylori Shi470
Pathway
hps05120  Epithelial cell signaling in Helicobacter pylori infection
Module
hps_M00564  Helicobacter pylori pathogenicity signature, cagA pathogenicity island
Brite
KEGG Orthology (KO) [BR:hps00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    HPSH_04295
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hps02044]
    HPSH_04295
Secretion system [BR:hps02044]
 Type IV secretion system
  Cag pathogenicity island (PAI) protein
   HPSH_04295
SSDB
Motif
Pfam: CagZ Lipoprotein_7
Other DBs
NCBI-ProteinID: ACD48294
Structure
PDB: 
1S2X

Position
838366..838965
AA seq 199 aa
MELGFNEAERQKILDSNRSLMGNANEVRDKFIQNYATSLKDSNDPQDFLRRVQELRINMQ
KNFISFDAYYNYLNNLVLASYNRCKQEKTFAESTIKNELTLGEFVVEISDNFNNFMCDEV
AKISDLVASYLPREYLPPFIDGNMMGVAFQILGIDDFGRKLNEIVQDIGTKYIILSKNKT
YLTSLERAKLITQLKLNLE
NT seq 600 nt   +upstreamnt  +downstreamnt
atggaactcggtttcaatgaagcagaaagacaaaaaatcttagacagcaacagatctctt
atgggaaatgcaaatgaagtaagggataagtttattcaaaattacgccacttctttaaaa
gatagcaacgatccgcaagattttttgagaagagttcaagagttaagaatcaatatgcag
aagaattttattagttttgatgcttattacaactatttgaacaaccttgtgttagccagt
tacaatcgttgcaaacaagaaaagacttttgcagaaagcacgatcaaaaatgaactaacg
cttggggagtttgttgtagaaatttctgacaacttcaataattttatgtgtgatgaagtg
gcaaaaatttcagacctagtggcttcttatctgccaagagagtatttaccgccattcata
gatggcaatatgatgggcgtggcgtttcagattctagggatagatgattttggaaggaag
ctcaatgagattgtccaagatatagggactaaatatattattttgagcaaaaataagact
tatctcacttctttagaaagagctaaattgataacccaattaaaattaaatttggaataa

DBGET integrated database retrieval system