KEGG   Helicobacter pylori Shi470: HPSH_04620
Entry
HPSH_04620        CDS       T00742                                 

Definition
(GenBank) hypothetical protein
Organism
hps  Helicobacter pylori Shi470
SSDB
Other DBs
NCBI-ProteinID: ACD48359
Position
complement(910570..910830)
AA seq 86 aa
MILNYVETINVREISKKEKFLKLNMNSWIISFLSASFLFVWSLLYGVVLLVALITMFYIL
EFFDEDITNIILANLTLKNDTKEYYA
NT seq 261 nt   +upstreamnt  +downstreamnt
atgattttaaattatgtagagaccatcaatgttagagaaatatctaaaaaagagaagttt
ttaaagcttaatatgaatagttggatcatttcttttttgagcgcttctttcttatttgtg
tggtctttattatatggcgtggtgctattggtggcattaataacaatgttttacatacta
gaattttttgatgaagatattacaaacattattttggcaaacctaacgctaaaaaatgac
actaaagaatattatgcttaa

DBGET integrated database retrieval system