KEGG   Helicobacter pylori Shi470: HPSH_05755Help
Entry
HPSH_05755        CDS       T00742                                 

Definition
(GenBank) gamma-glutamyltranspeptidase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
hps  Helicobacter pylori Shi470
Pathway
hps00430  Taurine and hypotaurine metabolism
hps00460  Cyanoamino acid metabolism
hps00480  Glutathione metabolism
hps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hps00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    HPSH_05755
   00460 Cyanoamino acid metabolism
    HPSH_05755
   00480 Glutathione metabolism
    HPSH_05755
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hps01002]
    HPSH_05755
Enzymes [BR:hps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     HPSH_05755
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     HPSH_05755
Peptidases and inhibitors [BR:hps01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   HPSH_05755
CD molecules [BR:hps04090]
 Proteins
  HPSH_05755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: ACD48557
Structure
PDB: 

Position
complement(1135096..1136799)
Genome map
AA seq 567 aa AA seqDB search
MRRSFLKTIGLGVIALSLGLLSPLSAASYPPIKNTKVGLALSSHPLASEIGQKVLEDGGN
AIDAAVAIGFALAVVHPAAGNIGGGGFAVIHLANGENVALDFREKAPLKATKDMFLDKQG
NVVPKLSEDGYLAAGVPGTVAGMEAMLKKYGTKKLSQLIDPAIKLAENGYVISQRQAETL
KEARERFLKYSSSKKYFFKKGHLDYQEGDLFVQKDLAKTLNQIKTLGAKGFYQGQVADLI
EKDMKKNGGIITKEDLASYNVKWRKPVVGSYRGYKIISMSPPSSGGTHLIQILNVMENAD
LSALGYGASKNIHIAAEAMRQAYADRSVYMGDADFVSVPVDKLINKAYAKKIFDAIQPDT
VTPSSQIKPGMGQLHEGSNTTHYSVADRWGNAVSVTYTINASYGSAASIDGAGFLLNNEM
DDFSIKPGNPNLYGLVGGDANAIEANKRPLSSMSPTIVLKNNKVFMVVGSPGGSRIITTV
LQVISNVIDYNMNISEAVSAPRFHMQWLPDELRIEKFGMPADVKNNLTKMGYQIVTKPVM
GDVNAIQVLPKTKGSVFYGSTDPRKEF
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgagacggagttttttgaaaacgattggcttgggtgtgatagcgctctctttgggtttg
ttaagccctttgagtgcagcgagttacccccccattaaaaacactaaagtaggcttagcc
ctttctagccacccgctagctagtgagatcgggcaaaaggttttagaagatggaggtaat
gcgattgatgcggctgtagcgataggttttgctctagcggtcgtccatcctgcagcaggc
aatattggtggtgggggttttgcggttatccatttggctaatggtgaaaatgttgcctta
gattttagagaaaaagcccccttaaaagccactaaggacatgtttttagacaagcaaggc
aatgtagtccctaagctcagcgaagatggctatttggcggctggggttcctggaacggtg
gcgggcatggaagcgatgttgaagaaatacggcacaaaaaagctatcgcaactcattgat
cctgccattaaattggctgaaaatggttatgtgatttcacaaagacaagcagaaacccta
aaagaagcaagggagcggtttttaaaatacagttctagcaaaaagtatttttttaaaaaa
gggcatcttgattatcaagaaggggatttgtttgtccaaaaagatttagccaagactttg
aatcaaatcaaaacgctaggcgctaaaggcttttatcaagggcaagtcgctgatttgatt
gagaaagacatgaaaaaaaatggagggattatcactaaagaagatttagccagttacaat
gtgaaatggcgcaaacccgtggtagggagttatcgtgggtataagatcatttctatgtcg
ccgccaagttcaggaggcacgcatttgatccagattttaaatgtcatggaaaatgcggat
ttaagtgcccttgggtatggggcttctaagaatatccatatcgctgcagaagcgatgcgt
caagcttatgcggacagatcggtttatatgggagacgctgattttgtttcagtgccggtg
gataaattgattaataaggcgtatgccaaaaagatttttgacgctatccagccagatacg
gttacgccaagctctcaaatcaaaccaggaatggggcagttgcatgaagggagcaatacc
acgcattattctgtagcggacaggtgggggaatgcagtcagcgttacttacaccattaac
gcttcttatggaagcgctgctagtattgatggggcaggatttttattgaacaatgaaatg
gatgatttttccataaagcctgggaatcctaatctctatggtttagtagggggcgatgcg
aatgcgattgaagccaataagcgccctttaagctccatgtcgcctacgatcgtgttgaaa
aacaataaggttttcatggtggtaggaagccctggagggtctaggattatcactacagtg
ttgcaagtgatttccaatgtcattgattacaacatgaatatttctgaagcggtctcagcc
cctagattccacatgcaatggttgcctgatgaattaaggattgaaaagtttggcatgcct
gctgatgtgaaaaataacctcactaaaatgggctatcaaatcgttactaagccagtcatg
ggtgatgtgaatgcgatccaagttttgcctaaaactaaagggagcgttttctatggatca
acggatccaaggaaagaattttaa

DBGET integrated database retrieval system