KEGG   Hydrogenophaga pseudoflava: HPF_13460Help
Entry
HPF_13460         CDS       T06073                                 

Gene name
icd1
Definition
(GenBank) Isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
hpse  Hydrogenophaga pseudoflava
Pathway
hpse00020  Citrate cycle (TCA cycle)
hpse00480  Glutathione metabolism
hpse01100  Metabolic pathways
hpse01110  Biosynthesis of secondary metabolites
hpse01120  Microbial metabolism in diverse environments
hpse01130  Biosynthesis of antibiotics
hpse01200  Carbon metabolism
hpse01210  2-Oxocarboxylic acid metabolism
hpse01230  Biosynthesis of amino acids
Module
hpse_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hpse_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:hpse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HPF_13460 (icd1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    HPF_13460 (icd1)
Enzymes [BR:hpse01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     HPF_13460 (icd1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: QBM28704
UniProt: A0A4P6X4R3
Position
complement(2813933..2815186)
Genome map
AA seq 417 aa AA seqDB search
MYQHIKVPAQGQKITVNQDMSLNVPDEPIVPYIEGDGTGLDITPVMLKVVDAAVEKAYGG
KRRIHWMEVFAGEKSTKVYGPDVWLPEETLAALREYVVSIKGPLTTPVGGGIRSLNVALR
QELDLYVCLRPVQYFKGVPSPLKEPEKTNMVIFRENSEDIYAGIEYAAQSDKAKKLIKFL
QDEMGVTKIRFPETSGIGIKPVSIEGTERLVRKAIQYAIDNDKPSVTLVHKGNIMKFTEG
GFRDWGYALAQKEFGAEPIDGGPWCQFKNPKTGRNIVIKDSIADAFLQQILLRPAEYSVI
ATLNLNGDYVSDALAAQVGGIGIAPGANLSDSVACFEATHGTAPKYAGKDYVNPGSEILS
AEMMLRHMGWTEAADLIISAMEQAILSKRVTYDFARLMDGATQVSCSGFGQVMIDHM
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtatcagcacatcaaggtgccggcccagggccagaagatcactgtcaatcaggacatg
tcgctgaacgtgccggatgagcctatcgttccctacatcgaaggcgatggcaccggtctg
gacatcacaccggtgatgctcaaggtggttgacgcggccgtggagaaagcctacggcggc
aagcgcaggatccactggatggaggtgttcgcgggcgagaagtcgaccaaggtgtatggc
cccgacgtctggctgccggaagagacgctggccgcgctcagggagtatgtggtctcgatc
aagggccctctgaccacgccggttgggggcgggatccgttccctgaacgtggcactgcgg
caggagttggacctgtacgtgtgtctgcggccggtgcagtacttcaaaggcgtgccgtcg
ccgctgaaggagcctgagaagaccaacatggtgatcttccgagaaaactcggaagacatc
tacgccggcatcgaatacgccgcccagagtgacaaggcgaagaagctgatcaagttcctg
caggacgagatgggcgtgaccaaaatccgcttccctgaaacctcgggcatcggcatcaag
ccggtgtcgatcgagggcaccgagcggctggtgcgtaaggcgatccagtatgcgatcgac
aacgacaagcccagcgtgaccctggtccacaagggcaacatcatgaagttcaccgagggc
ggtttccgcgactggggttatgccctggcccagaaggaattcggcgccgagcccatcgac
ggaggcccgtggtgccagttcaagaaccccaaaaccggccgcaacatcgtgatcaaggac
tcgattgcggacgccttcctgcagcagatcctgctgcggccggccgaatactcggtgatc
gccacgctcaacctcaatggcgactacgtctctgacgccctggcggcccaggtgggcggc
attggcatcgccccgggcgccaacctgtccgactcggtggcctgcttcgaagccacccac
ggcaccgcgccgaaatacgccggcaaggactacgtgaaccccggatccgagatcctgtcg
gctgaaatgatgttgcgtcacatgggctggacggaggccgccgacctgatcatttcggcc
atggagcaggccattctctccaagagggtgacctacgacttcgctcggctgatggacggg
gccacccaggtgtcctgttccggtttcgggcaggtcatgattgaccacatgtag

DBGET integrated database retrieval system