KEGG   Hydrogenophaga pseudoflava: HPF_17945Help
Entry
HPF_17945         CDS       T06073                                 

Gene name
pitA
Definition
(GenBank) Low-affinity inorganic phosphate transporter 1
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
hpse  Hydrogenophaga pseudoflava
Brite
KEGG Orthology (KO) [BR:hpse00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    HPF_17945 (pitA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 FGGY_C FeoB_C Myc_target_1
Motif
Other DBs
NCBI-ProteinID: QBM29583
UniProt: A0A4V1ABY5
Position
3761489..3762499
Genome map
AA seq 336 aa AA seqDB search
MTTVQAALWVVVMLVALALIFDFMNGFHDAANSIATIVSTGVLKPGQAVVFAAFFNFVAI
FIFKLSVAATVGKGIADPSVIDTHVVFGALSGAITWNLITWYYGIPSSSSHALIGGIVGA
VIAKAGAGALIATGVLRTVAFIFVSPLLGFILGSLMMVLVAWVFRRTRPLKVDGWFRRLQ
LVSAGAYSLGHGGNDAQKTIGIIWMLLIATGYASSADKSPPTWTIVSCYAAIGLGTMFGG
WRIVRTMGQKITKLKPVGGFCAETGGAMTLFLATALGIPVSTTHTITGAIVGVGSVQRAS
AVRWGVAGNIVWAWVLTIPASAFVAAVAYWFSLTVF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgttcaggcggccctctgggtcgtggtcatgctggtggcgctggcgctgatc
ttcgacttcatgaacgggtttcatgatgccgccaactcgatcgcgaccatcgtctccacc
ggcgtgctcaaacccgggcaagcggtggtgttcgccgcctttttcaacttcgttgccatc
ttcatcttcaagctcagcgtggcagccaccgtgggcaagggcatcgccgacccctcagtg
atcgatacgcacgtggtgttcggcgccctcagcggggcgatcacctggaacctgatcacc
tggtactacggcattcccagcagctcctctcacgcgctcatcggcggcatcgttggcgcc
gtgattgccaaggccggcgctggtgcgctgatcgccaccggcgtgctgcgcaccgtggcg
ttcatcttcgtctcgccgctgctgggtttcatcctgggctcgctgatgatggtcctggtg
gcctgggtattccgccgcacgcggccgctcaaggtcgatggctggttccggcggttgcag
ctggtctcggccggcgcctacagcctcggccacggcggcaacgatgcgcagaagacgatc
ggcatcatctggatgcttcttatagccaccggctacgcgtcatcggccgacaagtcgccg
ccgacctggaccatcgtgtcgtgctacgcggccatcggcctgggcaccatgttcggtggc
tggcgcattgtgcgcaccatgggccagaagatcaccaagctcaagccggtgggcggcttc
tgtgccgaaaccgggggcgcaatgacgctattcctcgctacagcgctgggcatccccgtg
tcgaccacccacaccatcaccggcgcgatcgttggcgtgggttcggtgcagcgcgccagc
gcagtgcgctggggggtggcgggcaacatcgtctgggcctgggtgctgaccatcccggcg
tcggccttcgtggctgcggtggcctactggttcagcctcacggtgttctga

DBGET integrated database retrieval system