KEGG   Helicobacter pylori Sat464: HPSAT_02300Help
Entry
HPSAT_02300       CDS       T01897                                 

Definition
(GenBank) type II adenine specific DNA methyltransferase
  KO
K06223  DNA adenine methylase [EC:2.1.1.72]
Organism
hpt  Helicobacter pylori Sat464
Pathway
hpt03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:hpt00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    HPSAT_02300
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hpt03032]
    HPSAT_02300
   03400 DNA repair and recombination proteins [BR:hpt03400]
    HPSAT_02300
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic Defense System [BR:hpt02048]
    HPSAT_02300
Enzymes [BR:hpt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.72  site-specific DNA-methyltransferase (adenine-specific)
     HPSAT_02300
DNA replication proteins [BR:hpt03032]
 Prokaryotic Type
  DNA Replication Termination Factors
   DNA methylation enzymes
    HPSAT_02300
DNA repair and recombination proteins [BR:hpt03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    Other MMR factors
     HPSAT_02300
Prokaryotic defense system [BR:hpt02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   DNA methyltransferases
    HPSAT_02300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MethyltransfD12
Motif
Other DBs
NCBI-ProteinID: ADO05207
Position
453875..454804
Genome map
AA seq 309 aa AA seqDB search
MHANLFNQNASKKDVFLHNLRSNNGRYKRYIKAPLRYGGGKSLAVGLIVEYIPNGVRRII
SPFIGGGSVEIACAAELGLEVLGFDIFDILVNFYQVLLKDKQALYNNLLSLEPTQETYNI
IKQELKAHYKKECVLDPLILARDYYFNFNLSYGPGFLGWMSKIYTDKQRYLNALLKIKGF
NAPSLKVECSSFEEVLLAYPNDFFYLDPPYVLENSKMFKGIYPMRNFPIHHNGFKHEVLA
HMLKRHKGPFILSYNDCEFVRNAYKDFKILEPSWQYTMGQGEIRMGKNRLERGDNNHVKQ
SHELLIIKE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcatgccaatttattcaaccaaaacgctagtaaaaaagatgtttttttgcacaattta
cgctccaataatgggcgttacaaacgctacataaaagcccctttaagatatggtgggggc
aagtctttagctgtagggttaatagtggagtatatacctaatggtgtgcgtaggattatt
agcccttttataggtggggggagcgtagaaattgcatgcgcggcagagttgggtttagaa
gtgttgggctttgatatttttgacattttagtgaatttttatcaagtgctactcaaagac
aaacaagctctttataataatttactctctttagaacctacacaagaaacttacaacatt
atcaaacaagagttaaaagcccattataaaaaagaatgcgttttagaccctttaattttg
gctagagattattactttaactttaatttaagctatgggccaggatttttagggtggatg
agtaaaatttacactgacaaacaacgctatctaaacgcccttttaaaaattaaaggtttt
aacgcccctagtttaaaggtggaatgctctagttttgaagaagtgttgctcgcttatcct
aatgattttttctatcttgaccccccttatgtgttagaaaattctaaaatgtttaagggg
atttatcctatgcgtaattttcctatccaccataatggttttaagcatgaagtcttagct
cacatgctaaaaaggcataaagggccatttattttaagttataatgattgcgaatttgta
aggaatgcttataaagattttaaaattttagagccatcttggcaatacactatgggacaa
ggcgagatcagaatgggtaaaaatcgcttagaaagaggcgataataaccatgtcaaacaa
tctcatgagttattgattatcaaggagtaa

DBGET integrated database retrieval system