KEGG   Helicobacter pylori Sat464: HPSAT_02325Help
Entry
HPSAT_02325       CDS       T01897                                 

Definition
(GenBank) outer membrane protein HofC
Organism
hpt  Helicobacter pylori Sat464
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HP_OMP_2
Motif
Other DBs
NCBI-ProteinID: ADO05212
Position
458782..460368
Genome map
AA seq 528 aa AA seqDB search
MKLKKRKVVATLLKRFTLPLVFTTGSLGAVTYEVHGDFINFSKVGFNHSPINPVKGIYPT
ETFVNLTGKLEGSVHLGRGWSVNLGGVLGGQVYDSTRYDRWAKDFTPPSYWDKTSCGTVS
SELCMNATKMWQQQGPGGVINTRGIGWEYMGEWNGLFPNYYPANAYLPGHSRRYEVYKAN
LTYDSDRVHMVMGRFDVTEQEQMDWVYQLFQGFYGTFKLTNKMKFLLFSGWGRGIADGQW
LFPIYREKPWGVHKAGIIYRPTKNLLIHPYVYLIPEVETDPGVKIEYDTNPGFSGRGIRN
RTAFYALYSYRWNNAEYGRYAPARYNTWDPFLDNGKWRGLQGPGGATLFLRHHIDINNYF
VVGGAYLNIGNPNMNLGTWGNIIAVDGIEQWVGSIYSLGFAGIDNITDADAFTEYVKGGG
KHGKFSWSVYQRFTTAPRALEYGIGMYLDYQFSKHVKAGLKLVWLEFQIRAGYNPGTGFL
GPNGQPLNLNNGLFESSAFAQGPQDMGGIKKSITQDRSHLMTHISYSF
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaagaaacgaaaagttgtagctacattgctaaagcgttttaccttgccacta
gtgttcactacgggttcattaggggcggttacttatgaagtgcatggggattttatcaat
ttctccaaagtgggttttaaccattcgcctattaaccctgttaaaggtatctaccccaca
gaaacttttgttaaccttacgggtaagctagaggggtctgtgcatttaggtaggggttgg
agcgtgaatttaggcggtgttttgggcggacaagtttatgatagcactaggtatgatagg
tgggcaaaggattttacccccccaagctattgggataaaacttcttgtggcactgtttct
tcagagctttgtatgaacgccactaaaatgtggcaacagcaaggaccaggtggtgtcatt
aacactagaggtattggttgggaatatatgggtgagtggaacggcttgttccctaactac
tatccggctaacgcttacttgcctgggcattcaaggcgctatgaagtttataaagcgaat
ctcacctatgatagcgatagagtccatatggtaatggggcgctttgatgttactgagcag
gagcaaatggattgggtttaccaattgttccaaggtttttatgggactttcaagctcacg
aataagatgaaattcttgctctttagcggttggggtcgtggtatcgctgatggtcagtgg
ttgttccctatctatcgtgaaaagccttggggggttcataaagcgggtattatttatcgc
cctacgaagaatttattgatccacccttatgtgtatcttatcccagaagtagaaacagat
cccggtgttaaaatagagtatgataccaatccggggtttagtggtaggggcattaggaat
agaacggctttctatgcgttatacagctatcgttggaataacgctgaatacggtcgttac
gcgcccgctcgttataacacttgggatccgttcttggataatggtaagtggcgtggcttg
caaggtcctggtggtgcgacgctctttttacgccaccatatagatattaacaactacttt
gtggttggtggtgcttatctcaacattggtaaccctaacatgaacttaggtacttggggt
aacatcatcgctgtggatggtatcgaacaatgggttggcagtatctacagcttagggttt
gcagggattgacaacattaccgatgctgacgcgttcactgaatatgttaaaggtggaggc
aagcatggtaagttcagttggagcgtttatcagcgcttcactaccgctccaagagctttg
gaatatggtattggtatgtatctagactatcagttcagcaagcatgttaaagcgggtctc
aaactcgtatggttagagttccaaatccgtgcgggttacaaccctggaaccggtttcctt
gggccaaacgggcaaccgcttaacttgaataatggtttgtttgaatcttccgcgttcgcg
caaggtcctcaagacatgggtggcattaaaaagagtattacccaagacagaagccattta
atgacacacattagttatagtttctaa

DBGET integrated database retrieval system